Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   JR441_RS12330 Genome accession   NZ_CP069789
Coordinates   2420598..2420981 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus subtilis strain BIM B-569G     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2415598..2425981
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JR441_RS12290 (JR441_12290) sinI 2416532..2416705 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  JR441_RS12295 (JR441_12295) sinR 2416739..2417074 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JR441_RS12300 (JR441_12300) tasA 2417167..2417952 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  JR441_RS12305 (JR441_12305) sipW 2418016..2418588 (-) 573 WP_072692741.1 signal peptidase I SipW -
  JR441_RS12310 (JR441_12310) tapA 2418572..2419333 (-) 762 WP_198878634.1 amyloid fiber anchoring/assembly protein TapA -
  JR441_RS12315 (JR441_12315) yqzG 2419605..2419931 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  JR441_RS12320 (JR441_12320) spoIITA 2419973..2420152 (-) 180 WP_072175549.1 YqzE family protein -
  JR441_RS12325 (JR441_12325) comGG 2420223..2420597 (-) 375 WP_133953114.1 ComG operon protein ComGG Machinery gene
  JR441_RS12330 (JR441_12330) comGF 2420598..2420981 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  JR441_RS12335 (JR441_12335) comGE 2421007..2421354 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene
  JR441_RS12340 (JR441_12340) comGD 2421338..2421769 (-) 432 WP_080529538.1 comG operon protein ComGD Machinery gene
  JR441_RS12345 (JR441_12345) comGC 2421759..2422055 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  JR441_RS12350 (JR441_12350) comGB 2422069..2423106 (-) 1038 WP_044052501.1 comG operon protein ComGB Machinery gene
  JR441_RS12355 (JR441_12355) comGA 2423093..2424163 (-) 1071 WP_129134318.1 competence protein ComGA Machinery gene
  JR441_RS12360 (JR441_12360) - 2424375..2424572 (-) 198 WP_129134319.1 hypothetical protein -
  JR441_RS12365 (JR441_12365) corA 2424574..2425527 (-) 954 WP_198878633.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=536617 JR441_RS12330 WP_032726158.1 2420598..2420981(-) (comGF) [Bacillus subtilis strain BIM B-569G]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=536617 JR441_RS12330 WP_032726158.1 2420598..2420981(-) (comGF) [Bacillus subtilis strain BIM B-569G]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992