Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JR311_RS15470 Genome accession   NZ_CP069391
Coordinates   3164670..3164810 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Sam8H1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3159670..3169810
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JR311_RS15445 (JR311_15445) - 3160010..3160393 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  JR311_RS15450 (JR311_15450) comA 3160415..3161059 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  JR311_RS15455 (JR311_15455) comP 3161140..3163431 (-) 2292 WP_204529906.1 histidine kinase Regulator
  JR311_RS15460 (JR311_15460) comX 3163443..3163607 (-) 165 WP_007613432.1 competence pheromone ComX -
  JR311_RS15465 (JR311_15465) - 3163607..3164518 (-) 912 WP_204530632.1 polyprenyl synthetase family protein -
  JR311_RS15470 (JR311_15470) degQ 3164670..3164810 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  JR311_RS15475 (JR311_15475) - 3165275..3165616 (+) 342 WP_156735720.1 hypothetical protein -
  JR311_RS15480 (JR311_15480) - 3165623..3166843 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  JR311_RS15485 (JR311_15485) - 3166973..3168439 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  JR311_RS15490 (JR311_15490) - 3168457..3169008 (-) 552 WP_080130030.1 cysteine hydrolase family protein -
  JR311_RS15495 (JR311_15495) - 3169105..3169503 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=534399 JR311_RS15470 WP_003152043.1 3164670..3164810(-) (degQ) [Bacillus velezensis strain Sam8H1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=534399 JR311_RS15470 WP_003152043.1 3164670..3164810(-) (degQ) [Bacillus velezensis strain Sam8H1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891