Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | JR311_RS15470 | Genome accession | NZ_CP069391 |
| Coordinates | 3164670..3164810 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain Sam8H1 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3159670..3169810
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JR311_RS15445 (JR311_15445) | - | 3160010..3160393 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| JR311_RS15450 (JR311_15450) | comA | 3160415..3161059 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| JR311_RS15455 (JR311_15455) | comP | 3161140..3163431 (-) | 2292 | WP_204529906.1 | histidine kinase | Regulator |
| JR311_RS15460 (JR311_15460) | comX | 3163443..3163607 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| JR311_RS15465 (JR311_15465) | - | 3163607..3164518 (-) | 912 | WP_204530632.1 | polyprenyl synthetase family protein | - |
| JR311_RS15470 (JR311_15470) | degQ | 3164670..3164810 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| JR311_RS15475 (JR311_15475) | - | 3165275..3165616 (+) | 342 | WP_156735720.1 | hypothetical protein | - |
| JR311_RS15480 (JR311_15480) | - | 3165623..3166843 (-) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| JR311_RS15485 (JR311_15485) | - | 3166973..3168439 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| JR311_RS15490 (JR311_15490) | - | 3168457..3169008 (-) | 552 | WP_080130030.1 | cysteine hydrolase family protein | - |
| JR311_RS15495 (JR311_15495) | - | 3169105..3169503 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=534399 JR311_RS15470 WP_003152043.1 3164670..3164810(-) (degQ) [Bacillus velezensis strain Sam8H1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=534399 JR311_RS15470 WP_003152043.1 3164670..3164810(-) (degQ) [Bacillus velezensis strain Sam8H1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |