Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | HMPREF1038_RS02775 | Genome accession | NC_018630 |
| Coordinates | 512157..512306 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae gamPNI0373 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 507157..517306
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HMPREF1038_RS02750 (HMPREF1038_00560) | blpC | 507421..507576 (-) | 156 | WP_000358812.1 | quorum-sensing system pheromone BlpC | - |
| HMPREF1038_RS02755 (HMPREF1038_00561) | - | 507633..508994 (-) | 1362 | WP_001069064.1 | bacteriocin secretion accessory protein | - |
| HMPREF1038_RS02760 (HMPREF1038_00562) | comA/nlmT | 509005..511158 (-) | 2154 | WP_000205159.1 | peptide cleavage/export ABC transporter BlpA | Regulator |
| HMPREF1038_RS02765 (HMPREF1038_00563) | blpM | 511440..511694 (+) | 255 | WP_001093255.1 | two-peptide bacteriocin subunit BlpM | - |
| HMPREF1038_RS02770 (HMPREF1038_00564) | blpN | 511710..511913 (+) | 204 | WP_001099490.1 | two-peptide bacteriocin subunit BlpN | - |
| HMPREF1038_RS02775 (HMPREF1038_00565) | cipB | 512157..512306 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| HMPREF1038_RS02780 (HMPREF1038_00567) | - | 512410..512529 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| HMPREF1038_RS02795 (HMPREF1038_00569) | - | 513010..513368 (+) | 359 | Protein_536 | immunity protein | - |
| HMPREF1038_RS02805 (HMPREF1038_00570) | - | 513997..514380 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| HMPREF1038_RS02810 (HMPREF1038_00571) | - | 514432..515121 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| HMPREF1038_RS02815 (HMPREF1038_00572) | blpZ | 515163..515396 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| HMPREF1038_RS02820 (HMPREF1038_00573) | - | 515547..516158 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| HMPREF1038_RS02825 (HMPREF1038_00574) | ccrZ | 516319..517113 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=53333 HMPREF1038_RS02775 WP_001809846.1 512157..512306(+) (cipB) [Streptococcus pneumoniae gamPNI0373]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=53333 HMPREF1038_RS02775 WP_001809846.1 512157..512306(+) (cipB) [Streptococcus pneumoniae gamPNI0373]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |