Detailed information
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | LLI11_RS11400 | Genome accession | NZ_CP069223 |
| Coordinates | 2229015..2229341 (-) | Length | 108 a.a. |
| NCBI ID | WP_058221568.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain I.1.1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2227450..2265392 | 2229015..2229341 | within | 0 |
Gene organization within MGE regions
Location: 2227450..2265392
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLI11_RS11390 (LLI11_11330) | - | 2227450..2227887 (-) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLI11_RS11395 (LLI11_11335) | - | 2228094..2229041 (+) | 948 | WP_003130410.1 | IS30 family transposase | - |
| LLI11_RS11400 (LLI11_11340) | comGG | 2229015..2229341 (-) | 327 | WP_058221568.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLI11_RS11405 (LLI11_11345) | comGF | 2229391..2229819 (-) | 429 | Protein_2221 | competence type IV pilus minor pilin ComGF | - |
| LLI11_RS11410 (LLI11_11350) | comGE | 2229782..2230078 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLI11_RS11415 (LLI11_11355) | comGD | 2230050..2230481 (-) | 432 | WP_080585155.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LLI11_RS11420 (LLI11_11360) | comGC | 2230441..2230710 (-) | 270 | WP_003129998.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLI11_RS11425 (LLI11_11365) | - | 2230837..2231529 (-) | 693 | WP_152994386.1 | hypothetical protein | - |
| LLI11_RS11430 (LLI11_11370) | - | 2231771..2232550 (-) | 780 | WP_082225220.1 | peptidoglycan amidohydrolase family protein | - |
| LLI11_RS11435 (LLI11_11375) | - | 2232550..2232849 (-) | 300 | WP_031559226.1 | phage holin | - |
| LLI11_RS11440 (LLI11_11380) | - | 2232862..2233212 (-) | 351 | WP_014570798.1 | hypothetical protein | - |
| LLI11_RS11445 (LLI11_11385) | - | 2233225..2233461 (-) | 237 | WP_082225257.1 | hypothetical protein | - |
| LLI11_RS11450 (LLI11_11390) | - | 2233473..2237738 (-) | 4266 | WP_243525488.1 | hypothetical protein | - |
| LLI11_RS11455 (LLI11_11395) | - | 2237717..2239246 (-) | 1530 | WP_003131327.1 | distal tail protein Dit | - |
| LLI11_RS11460 (LLI11_11400) | - | 2239256..2241865 (-) | 2610 | WP_058221395.1 | phage tail tape measure protein | - |
| LLI11_RS11465 (LLI11_11405) | - | 2241855..2242562 (-) | 708 | WP_003131324.1 | Gp15 family bacteriophage protein | - |
| LLI11_RS11470 (LLI11_11410) | - | 2242578..2242985 (-) | 408 | WP_058221396.1 | hypothetical protein | - |
| LLI11_RS11475 (LLI11_11415) | - | 2243042..2243518 (-) | 477 | WP_014570559.1 | phage tail tube protein | - |
| LLI11_RS11480 (LLI11_11420) | - | 2243529..2243963 (-) | 435 | WP_003131321.1 | minor capsid protein | - |
| LLI11_RS11485 (LLI11_11425) | - | 2243963..2244292 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| LLI11_RS11490 (LLI11_11430) | - | 2244289..2244633 (-) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| LLI11_RS11495 (LLI11_11435) | - | 2244623..2245024 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| LLI11_RS11500 (LLI11_11440) | - | 2245098..2245334 (-) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| LLI11_RS11505 (LLI11_11445) | - | 2245363..2246280 (-) | 918 | WP_003131315.1 | hypothetical protein | - |
| LLI11_RS11510 (LLI11_11450) | - | 2246295..2247344 (-) | 1050 | WP_003131314.1 | XkdF-like putative serine protease domain-containing protein | - |
| LLI11_RS11515 (LLI11_11455) | - | 2247360..2248190 (-) | 831 | WP_003131311.1 | phage minor head protein | - |
| LLI11_RS11520 (LLI11_11460) | - | 2248183..2249712 (-) | 1530 | WP_058221397.1 | phage portal protein | - |
| LLI11_RS11525 (LLI11_11465) | terL | 2249725..2251176 (-) | 1452 | WP_014570551.1 | phage terminase large subunit | - |
| LLI11_RS11530 (LLI11_11470) | - | 2251157..2251630 (-) | 474 | WP_058221398.1 | transposase | - |
| LLI11_RS11535 (LLI11_11475) | - | 2251801..2252190 (-) | 390 | WP_058221399.1 | DUF722 domain-containing protein | - |
| LLI11_RS11540 (LLI11_11480) | - | 2252267..2252575 (-) | 309 | WP_082225258.1 | hypothetical protein | - |
| LLI11_RS11545 (LLI11_11485) | - | 2252704..2252919 (-) | 216 | WP_058221541.1 | DUF1660 domain-containing protein | - |
| LLI11_RS11550 (LLI11_11490) | - | 2252916..2253134 (-) | 219 | WP_014570803.1 | hypothetical protein | - |
| LLI11_RS11555 (LLI11_11495) | - | 2253153..2253872 (-) | 720 | WP_082225259.1 | hypothetical protein | - |
| LLI11_RS11560 (LLI11_11500) | - | 2253899..2254258 (-) | 360 | WP_082225260.1 | hypothetical protein | - |
| LLI11_RS11565 (LLI11_11505) | dut | 2254262..2254681 (-) | 420 | WP_082225261.1 | dUTP diphosphatase | - |
| LLI11_RS11570 (LLI11_13915) | - | 2254678..2255043 (-) | 366 | WP_082225262.1 | DUF1642 domain-containing protein | - |
| LLI11_RS11575 (LLI11_11515) | - | 2255040..2255582 (-) | 543 | WP_145952586.1 | DUF1642 domain-containing protein | - |
| LLI11_RS11580 (LLI11_13920) | - | 2255575..2255757 (-) | 183 | WP_243525495.1 | hypothetical protein | - |
| LLI11_RS11585 (LLI11_13925) | - | 2255776..2255934 (-) | 159 | WP_228763273.1 | hypothetical protein | - |
| LLI11_RS11590 (LLI11_11525) | - | 2256126..2256332 (-) | 207 | WP_014570535.1 | hypothetical protein | - |
| LLI11_RS11595 (LLI11_11530) | - | 2256440..2256850 (-) | 411 | WP_014570810.1 | hypothetical protein | - |
| LLI11_RS11600 (LLI11_13930) | - | 2256863..2257159 (-) | 297 | WP_284303385.1 | L-rhamnose isomerase | - |
| LLI11_RS11605 (LLI11_11545) | - | 2257198..2258124 (-) | 927 | WP_058221710.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LLI11_RS11610 (LLI11_11550) | - | 2258387..2259454 (-) | 1068 | WP_058221711.1 | DUF1351 domain-containing protein | - |
| LLI11_RS11615 (LLI11_11555) | bet | 2259456..2260193 (-) | 738 | WP_058212836.1 | phage recombination protein Bet | - |
| LLI11_RS11620 (LLI11_11560) | - | 2260300..2260476 (-) | 177 | WP_032943269.1 | putative transcriptional regulator | - |
| LLI11_RS11625 (LLI11_11565) | - | 2260473..2260721 (-) | 249 | WP_058221712.1 | hypothetical protein | - |
| LLI11_RS11630 (LLI11_13935) | - | 2260734..2260856 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| LLI11_RS11635 (LLI11_11570) | - | 2260853..2261035 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| LLI11_RS11640 (LLI11_11575) | - | 2261051..2261740 (-) | 690 | WP_058221713.1 | Rha family transcriptional regulator | - |
| LLI11_RS11645 (LLI11_11580) | - | 2261799..2262032 (-) | 234 | WP_014570819.1 | helix-turn-helix transcriptional regulator | - |
| LLI11_RS11650 (LLI11_11585) | - | 2262209..2262619 (+) | 411 | WP_014570820.1 | helix-turn-helix domain-containing protein | - |
| LLI11_RS11655 (LLI11_11590) | - | 2262630..2263214 (+) | 585 | WP_058221714.1 | hypothetical protein | - |
| LLI11_RS11660 (LLI11_11595) | - | 2263270..2263809 (+) | 540 | WP_023189015.1 | PH domain-containing protein | - |
| LLI11_RS11665 (LLI11_11600) | - | 2263935..2265392 (+) | 1458 | WP_058221720.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 108 a.a. Molecular weight: 12234.69 Da Isoelectric Point: 6.0669
>NTDB_id=533115 LLI11_RS11400 WP_058221568.1 2229015..2229341(-) (comGG) [Lactococcus lactis subsp. lactis strain I.1.1]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKNANCKSKLASQAHLI
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKNANCKSKLASQAHLI
Nucleotide
Download Length: 327 bp
>NTDB_id=533115 LLI11_RS11400 WP_058221568.1 2229015..2229341(-) (comGG) [Lactococcus lactis subsp. lactis strain I.1.1]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAACGCAAATTGCAAGTCCAAGTTAGCCAGCCAAGCTCATCT
CATATGA
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAACGCAAATTGCAAGTCCAAGTTAGCCAGCCAAGCTCATCT
CATATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
58.065 |
86.111 |
0.5 |