Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   JOF24_RS11915 Genome accession   NZ_CP069214
Coordinates   2480567..2480944 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain GUAL210     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2475567..2485944
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JOF24_RS11875 - 2476064..2476858 (+) 795 WP_014418368.1 YqhG family protein -
  JOF24_RS11880 sinI 2477035..2477208 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  JOF24_RS11885 sinR 2477242..2477577 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JOF24_RS11890 - 2477625..2478410 (-) 786 WP_007408329.1 TasA family protein -
  JOF24_RS11895 - 2478475..2479059 (-) 585 WP_012117977.1 signal peptidase I -
  JOF24_RS11900 tapA 2479031..2479702 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  JOF24_RS11905 - 2479961..2480290 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  JOF24_RS11910 - 2480331..2480510 (-) 180 WP_003153093.1 YqzE family protein -
  JOF24_RS11915 comGG 2480567..2480944 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  JOF24_RS11920 comGF 2480945..2481445 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  JOF24_RS11925 comGE 2481354..2481668 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  JOF24_RS11930 comGD 2481652..2482089 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  JOF24_RS11935 comGC 2482079..2482387 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  JOF24_RS11940 comGB 2482392..2483429 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  JOF24_RS11945 comGA 2483416..2484486 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  JOF24_RS11950 - 2484679..2485629 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=532972 JOF24_RS11915 WP_015417814.1 2480567..2480944(-) (comGG) [Bacillus velezensis strain GUAL210]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=532972 JOF24_RS11915 WP_015417814.1 2480567..2480944(-) (comGG) [Bacillus velezensis strain GUAL210]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504