Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   JOF24_RS11880 Genome accession   NZ_CP069214
Coordinates   2477035..2477208 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain GUAL210     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2472035..2482208
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JOF24_RS11865 gcvT 2472848..2473948 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  JOF24_RS11870 - 2474372..2476042 (+) 1671 WP_021494309.1 SNF2-related protein -
  JOF24_RS11875 - 2476064..2476858 (+) 795 WP_014418368.1 YqhG family protein -
  JOF24_RS11880 sinI 2477035..2477208 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  JOF24_RS11885 sinR 2477242..2477577 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JOF24_RS11890 - 2477625..2478410 (-) 786 WP_007408329.1 TasA family protein -
  JOF24_RS11895 - 2478475..2479059 (-) 585 WP_012117977.1 signal peptidase I -
  JOF24_RS11900 tapA 2479031..2479702 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  JOF24_RS11905 - 2479961..2480290 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  JOF24_RS11910 - 2480331..2480510 (-) 180 WP_003153093.1 YqzE family protein -
  JOF24_RS11915 comGG 2480567..2480944 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  JOF24_RS11920 comGF 2480945..2481445 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  JOF24_RS11925 comGE 2481354..2481668 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  JOF24_RS11930 comGD 2481652..2482089 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=532970 JOF24_RS11880 WP_003153105.1 2477035..2477208(+) (sinI) [Bacillus velezensis strain GUAL210]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=532970 JOF24_RS11880 WP_003153105.1 2477035..2477208(+) (sinI) [Bacillus velezensis strain GUAL210]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702