Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LLNCDO700_RS12095 | Genome accession | NZ_CP069179 |
| Coordinates | 2350953..2351087 (-) | Length | 44 a.a. |
| NCBI ID | WP_259683622.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain NCDO700 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2303380..2350956 | 2350953..2351087 | flank | -3 |
Gene organization within MGE regions
Location: 2303380..2351087
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLNCDO700_RS11770 (LLNCDO700_11725) | - | 2304846..2305655 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLNCDO700_RS11775 (LLNCDO700_11730) | - | 2305648..2306385 (-) | 738 | WP_011836039.1 | metal ABC transporter ATP-binding protein | - |
| LLNCDO700_RS11780 (LLNCDO700_11735) | - | 2306564..2307406 (-) | 843 | WP_259692036.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLNCDO700_RS11785 (LLNCDO700_11740) | - | 2307403..2307840 (-) | 438 | WP_011836041.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLNCDO700_RS11790 (LLNCDO700_11745) | comGG | 2307921..2308220 (-) | 300 | WP_011836042.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLNCDO700_RS11795 (LLNCDO700_11750) | comGF | 2308244..2308669 (-) | 426 | WP_014735174.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLNCDO700_RS11800 (LLNCDO700_11755) | comGE | 2308653..2308949 (-) | 297 | WP_259692037.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLNCDO700_RS11805 (LLNCDO700_11760) | comGD | 2308921..2309301 (-) | 381 | WP_289652431.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LLNCDO700_RS11810 (LLNCDO700_11765) | comGC | 2309312..2309581 (-) | 270 | WP_259692038.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLNCDO700_RS11815 (LLNCDO700_11770) | - | 2309627..2310883 (-) | 1257 | WP_262674378.1 | Fic family protein | - |
| LLNCDO700_RS13700 | - | 2311289..2311357 (-) | 69 | WP_228764452.1 | hypothetical protein | - |
| LLNCDO700_RS11825 (LLNCDO700_11785) | - | 2311894..2312460 (-) | 567 | WP_098383984.1 | hypothetical protein | - |
| LLNCDO700_RS11830 (LLNCDO700_11790) | - | 2312486..2313496 (-) | 1011 | WP_098383985.1 | DUF6731 family protein | - |
| LLNCDO700_RS11835 (LLNCDO700_11795) | - | 2313717..2315006 (-) | 1290 | WP_262674379.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LLNCDO700_RS11840 (LLNCDO700_11800) | - | 2315003..2315269 (-) | 267 | WP_015966839.1 | phage holin | - |
| LLNCDO700_RS11845 (LLNCDO700_11805) | - | 2315281..2315508 (-) | 228 | WP_058221378.1 | hemolysin XhlA family protein | - |
| LLNCDO700_RS11850 (LLNCDO700_11810) | - | 2315662..2317338 (-) | 1677 | WP_262674380.1 | DUF7013 family protein | - |
| LLNCDO700_RS11855 (LLNCDO700_11815) | - | 2317338..2317475 (-) | 138 | WP_262674381.1 | hypothetical protein | - |
| LLNCDO700_RS11860 (LLNCDO700_11820) | - | 2317472..2320009 (-) | 2538 | WP_289652432.1 | gp58-like family protein | - |
| LLNCDO700_RS11865 (LLNCDO700_11825) | - | 2320021..2320386 (-) | 366 | WP_011676906.1 | DUF6711 family protein | - |
| LLNCDO700_RS11870 (LLNCDO700_11830) | - | 2320398..2325098 (-) | 4701 | WP_289652433.1 | phage tail protein | - |
| LLNCDO700_RS11875 (LLNCDO700_11835) | - | 2325130..2325501 (-) | 372 | WP_014734984.1 | hypothetical protein | - |
| LLNCDO700_RS11880 (LLNCDO700_11840) | - | 2325525..2325935 (-) | 411 | WP_143457692.1 | DUF6096 family protein | - |
| LLNCDO700_RS11885 (LLNCDO700_11845) | - | 2326180..2326593 (-) | 414 | WP_047686566.1 | phage tail tube protein | - |
| LLNCDO700_RS11890 (LLNCDO700_11850) | - | 2326606..2326968 (-) | 363 | WP_143457691.1 | hypothetical protein | - |
| LLNCDO700_RS11895 (LLNCDO700_11855) | - | 2326968..2327459 (-) | 492 | WP_143457690.1 | HK97 gp10 family phage protein | - |
| LLNCDO700_RS11900 (LLNCDO700_11860) | - | 2327500..2327853 (-) | 354 | WP_259687975.1 | hypothetical protein | - |
| LLNCDO700_RS11905 (LLNCDO700_11865) | - | 2327834..2328166 (-) | 333 | WP_143457688.1 | phage head-tail connector protein | - |
| LLNCDO700_RS11910 (LLNCDO700_11870) | - | 2328187..2329305 (-) | 1119 | WP_262674384.1 | Ig-like domain-containing protein | - |
| LLNCDO700_RS11915 (LLNCDO700_11875) | - | 2329317..2329973 (-) | 657 | WP_262674385.1 | DUF4355 domain-containing protein | - |
| LLNCDO700_RS11920 (LLNCDO700_11880) | - | 2330107..2330628 (-) | 522 | WP_262674386.1 | hypothetical protein | - |
| LLNCDO700_RS11925 (LLNCDO700_11885) | - | 2330661..2331758 (-) | 1098 | WP_262674387.1 | minor capsid protein | - |
| LLNCDO700_RS11930 (LLNCDO700_11890) | - | 2331764..2332051 (-) | 288 | WP_262674388.1 | ribosomal-processing cysteine protease Prp | - |
| LLNCDO700_RS11935 (LLNCDO700_11895) | - | 2332048..2332212 (-) | 165 | WP_262674389.1 | hypothetical protein | - |
| LLNCDO700_RS11940 (LLNCDO700_11900) | - | 2332169..2333656 (-) | 1488 | WP_262674390.1 | phage portal protein | - |
| LLNCDO700_RS11945 (LLNCDO700_11905) | - | 2333666..2334955 (-) | 1290 | WP_375378624.1 | PBSX family phage terminase large subunit | - |
| LLNCDO700_RS11950 (LLNCDO700_11910) | - | 2334942..2335388 (-) | 447 | WP_225666720.1 | terminase small subunit | - |
| LLNCDO700_RS11955 (LLNCDO700_11915) | - | 2335683..2336108 (-) | 426 | WP_259692478.1 | RinA family protein | - |
| LLNCDO700_RS11960 (LLNCDO700_11920) | - | 2336185..2336493 (-) | 309 | WP_021215999.1 | hypothetical protein | - |
| LLNCDO700_RS11965 (LLNCDO700_11925) | - | 2336613..2336846 (+) | 234 | WP_231722930.1 | hypothetical protein | - |
| LLNCDO700_RS11970 (LLNCDO700_11930) | - | 2337039..2337215 (-) | 177 | WP_260368638.1 | hypothetical protein | - |
| LLNCDO700_RS11975 (LLNCDO700_11935) | - | 2337215..2337424 (-) | 210 | WP_262674391.1 | DUF1660 domain-containing protein | - |
| LLNCDO700_RS11980 (LLNCDO700_11940) | - | 2337421..2337639 (-) | 219 | WP_011834792.1 | hypothetical protein | - |
| LLNCDO700_RS11985 (LLNCDO700_11945) | - | 2337658..2337996 (-) | 339 | WP_262674392.1 | DUF1140 family protein | - |
| LLNCDO700_RS11990 (LLNCDO700_11950) | - | 2337997..2338416 (-) | 420 | WP_138405884.1 | dUTP diphosphatase | - |
| LLNCDO700_RS11995 (LLNCDO700_11955) | - | 2338413..2338724 (-) | 312 | WP_262674393.1 | hypothetical protein | - |
| LLNCDO700_RS12000 (LLNCDO700_13960) | - | 2338721..2339377 (-) | 657 | WP_262674394.1 | DUF1642 domain-containing protein | - |
| LLNCDO700_RS12005 (LLNCDO700_11965) | - | 2339364..2339576 (-) | 213 | WP_262674395.1 | DUF1125 domain-containing protein | - |
| LLNCDO700_RS12010 (LLNCDO700_11970) | - | 2339590..2340114 (-) | 525 | WP_259692096.1 | hypothetical protein | - |
| LLNCDO700_RS12015 (LLNCDO700_11975) | - | 2340220..2340459 (-) | 240 | WP_011834786.1 | DUF1031 domain-containing protein | - |
| LLNCDO700_RS12020 (LLNCDO700_11980) | - | 2340460..2340879 (-) | 420 | WP_046781573.1 | hypothetical protein | - |
| LLNCDO700_RS12025 (LLNCDO700_11985) | - | 2340869..2341090 (-) | 222 | WP_015966888.1 | hypothetical protein | - |
| LLNCDO700_RS12030 (LLNCDO700_11990) | - | 2341071..2341904 (-) | 834 | WP_259692089.1 | DnaD domain protein | - |
| LLNCDO700_RS12035 (LLNCDO700_11995) | - | 2342129..2343196 (-) | 1068 | WP_252172345.1 | DUF1351 domain-containing protein | - |
| LLNCDO700_RS12040 (LLNCDO700_12000) | bet | 2343198..2343935 (-) | 738 | WP_262674396.1 | phage recombination protein Bet | - |
| LLNCDO700_RS12045 (LLNCDO700_12005) | - | 2344039..2344275 (-) | 237 | WP_262674397.1 | DUF1408 domain-containing protein | - |
| LLNCDO700_RS12050 (LLNCDO700_12010) | - | 2344378..2344656 (+) | 279 | WP_011834777.1 | hypothetical protein | - |
| LLNCDO700_RS12055 (LLNCDO700_12020) | - | 2345189..2345899 (-) | 711 | WP_260318346.1 | ORF6C domain-containing protein | - |
| LLNCDO700_RS12060 (LLNCDO700_12025) | - | 2345997..2346251 (+) | 255 | WP_216528058.1 | DUF2513 domain-containing protein | - |
| LLNCDO700_RS12065 (LLNCDO700_12030) | - | 2346279..2346650 (-) | 372 | WP_216528059.1 | hypothetical protein | - |
| LLNCDO700_RS12070 (LLNCDO700_12035) | - | 2346720..2346950 (-) | 231 | WP_042749062.1 | helix-turn-helix transcriptional regulator | - |
| LLNCDO700_RS12075 (LLNCDO700_12040) | - | 2347104..2347463 (+) | 360 | WP_259692254.1 | hypothetical protein | - |
| LLNCDO700_RS12080 (LLNCDO700_12045) | - | 2347833..2348693 (+) | 861 | WP_259692253.1 | S24 family peptidase | - |
| LLNCDO700_RS12085 (LLNCDO700_12050) | - | 2348750..2349376 (+) | 627 | WP_259692252.1 | OB-fold protein | - |
| LLNCDO700_RS12090 (LLNCDO700_12055) | - | 2349499..2350956 (+) | 1458 | WP_259692251.1 | recombinase family protein | - |
| LLNCDO700_RS12095 (LLNCDO700_12060) | comGC | 2350953..2351087 (-) | 135 | WP_259683622.1 | hypothetical protein | Machinery gene |
Sequence
Protein
Download Length: 44 a.a. Molecular weight: 5208.35 Da Isoelectric Point: 11.2470
>NTDB_id=532759 LLNCDO700_RS12095 WP_259683622.1 2350953..2351087(-) (comGC) [Lactococcus cremoris strain NCDO700]
MKIENITLIMSKALSLVKIHGRKLWQKKQKAFTLIEINEIKTRN
MKIENITLIMSKALSLVKIHGRKLWQKKQKAFTLIEINEIKTRN
Nucleotide
Download Length: 135 bp
>NTDB_id=532759 LLNCDO700_RS12095 WP_259683622.1 2350953..2351087(-) (comGC) [Lactococcus cremoris strain NCDO700]
ATGAAAATAGAAAATATAACTTTAATAATGAGCAAAGCTTTGTCATTAGTTAAAATTCACGGAAGAAAGCTTTGGCAAAA
AAAGCAAAAAGCATTTACCTTGATTGAAATAAACGAAATAAAAACTCGCAATTAA
ATGAAAATAGAAAATATAACTTTAATAATGAGCAAAGCTTTGTCATTAGTTAAAATTCACGGAAGAAAGCTTTGGCAAAA
AAAGCAAAAAGCATTTACCTTGATTGAAATAAACGAAATAAAAACTCGCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Lactococcus lactis subsp. cremoris KW2 |
92.857 |
63.636 |
0.591 |