Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JNE45_RS14765 Genome accession   NZ_CP069061
Coordinates   2893444..2893584 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain F6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2888444..2898584
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JNE45_RS14740 (JNE45_14740) - 2888766..2889155 (-) 390 WP_203128790.1 hotdog fold thioesterase -
  JNE45_RS14745 (JNE45_14745) comA 2889179..2889820 (-) 642 WP_144472265.1 response regulator transcription factor Regulator
  JNE45_RS14750 (JNE45_14750) comP 2889901..2892207 (-) 2307 WP_203128791.1 ATP-binding protein Regulator
  JNE45_RS14755 (JNE45_14755) comX 2892221..2892391 (-) 171 WP_012011107.1 competence pheromone ComX -
  JNE45_RS14760 (JNE45_14760) - 2892369..2893292 (-) 924 WP_203128792.1 polyprenyl synthetase family protein -
  JNE45_RS14765 (JNE45_14765) degQ 2893444..2893584 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  JNE45_RS14770 (JNE45_14770) - 2894090..2894446 (+) 357 WP_144472257.1 inner spore coat protein -
  JNE45_RS14775 (JNE45_14775) - 2894480..2895706 (-) 1227 WP_095409469.1 EAL and HDOD domain-containing protein -
  JNE45_RS14780 (JNE45_14780) - 2895844..2897316 (-) 1473 WP_203128793.1 nicotinate phosphoribosyltransferase -
  JNE45_RS14785 (JNE45_14785) - 2897334..2897885 (-) 552 WP_095409470.1 cysteine hydrolase family protein -
  JNE45_RS14790 (JNE45_14790) - 2897946..2898353 (-) 408 WP_203128794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=532066 JNE45_RS14765 WP_003213123.1 2893444..2893584(-) (degQ) [Bacillus safensis strain F6]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=532066 JNE45_RS14765 WP_003213123.1 2893444..2893584(-) (degQ) [Bacillus safensis strain F6]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696