Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JNE32_RS17640 Genome accession   NZ_CP068982
Coordinates   3317122..3317262 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain pb2441     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3312122..3322262
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JNE32_RS17615 (JNE32_17520) yuxO 3312398..3312778 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  JNE32_RS17620 (JNE32_17525) comA 3312797..3313441 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  JNE32_RS17625 (JNE32_17530) comP 3313522..3315834 (-) 2313 WP_072692758.1 histidine kinase Regulator
  JNE32_RS17630 (JNE32_17535) comX 3315850..3316071 (-) 222 WP_014114983.1 competence pheromone ComX -
  JNE32_RS17635 (JNE32_17540) - 3316068..3316937 (-) 870 WP_015714626.1 polyprenyl synthetase family protein -
  JNE32_RS17640 (JNE32_17545) degQ 3317122..3317262 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  JNE32_RS17645 (JNE32_17550) - 3317484..3317609 (+) 126 WP_121549029.1 hypothetical protein -
  JNE32_RS17650 (JNE32_17555) - 3317724..3318092 (+) 369 WP_038427878.1 hypothetical protein -
  JNE32_RS17655 (JNE32_17560) pdeH 3318068..3319297 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  JNE32_RS17660 (JNE32_17565) pncB 3319434..3320906 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  JNE32_RS17665 (JNE32_17570) pncA 3320922..3321473 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  JNE32_RS17670 (JNE32_17575) yueI 3321570..3321968 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=531757 JNE32_RS17640 WP_003220708.1 3317122..3317262(-) (degQ) [Bacillus subtilis strain pb2441]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=531757 JNE32_RS17640 WP_003220708.1 3317122..3317262(-) (degQ) [Bacillus subtilis strain pb2441]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1