Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JKJ03_RS14715 Genome accession   NZ_CP068563
Coordinates   3001764..3001904 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain GUMT319     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2996764..3006904
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JKJ03_RS14690 (JKJ03_14690) - 2997104..2997487 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  JKJ03_RS14695 (JKJ03_14695) comA 2997509..2998153 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  JKJ03_RS14700 (JKJ03_14700) comP 2998234..3000525 (-) 2292 WP_039254056.1 histidine kinase Regulator
  JKJ03_RS14705 (JKJ03_14705) comX 3000537..3000701 (-) 165 WP_007613432.1 competence pheromone ComX -
  JKJ03_RS14710 (JKJ03_14710) - 3000701..3001612 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  JKJ03_RS14715 (JKJ03_14715) degQ 3001764..3001904 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  JKJ03_RS14720 (JKJ03_14720) - 3002370..3002711 (+) 342 WP_202735689.1 hypothetical protein -
  JKJ03_RS14725 (JKJ03_14725) - 3002718..3003938 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  JKJ03_RS14730 (JKJ03_14730) - 3004068..3005534 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  JKJ03_RS14735 (JKJ03_14735) - 3005552..3006103 (-) 552 WP_025853916.1 cysteine hydrolase family protein -
  JKJ03_RS14740 (JKJ03_14740) - 3006200..3006598 (-) 399 WP_202735690.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=529489 JKJ03_RS14715 WP_003152043.1 3001764..3001904(-) (degQ) [Bacillus velezensis strain GUMT319]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=529489 JKJ03_RS14715 WP_003152043.1 3001764..3001904(-) (degQ) [Bacillus velezensis strain GUMT319]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891