Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   U712_RS15380 Genome accession   NC_022898
Coordinates   3073707..3073874 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis PY79     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3068707..3078874
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U712_RS15350 (U712_15760) mrpE 3069102..3069578 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  U712_RS15355 (U712_15765) mrpF 3069578..3069862 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  U712_RS15360 (U712_15770) mnhG 3069846..3070220 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  U712_RS15365 (U712_15775) yuxO 3070259..3070639 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  U712_RS15370 (U712_15780) comA 3070658..3071302 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  U712_RS15375 (U712_15785) comP 3071383..3073692 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  U712_RS15380 (U712_15790) comX 3073707..3073874 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  U712_RS15385 (U712_15795) comQ 3073862..3074761 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  U712_RS15390 (U712_15800) degQ 3074946..3075086 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  U712_RS21380 (U712_15805) - 3075308..3075433 (+) 126 WP_003228793.1 hypothetical protein -
  U712_RS15395 (U712_15810) - 3075547..3075915 (+) 369 WP_003243784.1 hypothetical protein -
  U712_RS15400 (U712_15815) pdeH 3075891..3077120 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  U712_RS15405 (U712_15820) pncB 3077257..3078729 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=52943 U712_RS15380 WP_003242801.1 3073707..3073874(-) (comX) [Bacillus subtilis PY79]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=52943 U712_RS15380 WP_003242801.1 3073707..3073874(-) (comX) [Bacillus subtilis PY79]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment