Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   U712_RS15390 Genome accession   NC_022898
Coordinates   3074946..3075086 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis PY79     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3069946..3080086
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U712_RS15365 (U712_15775) yuxO 3070259..3070639 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  U712_RS15370 (U712_15780) comA 3070658..3071302 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  U712_RS15375 (U712_15785) comP 3071383..3073692 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  U712_RS15380 (U712_15790) comX 3073707..3073874 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  U712_RS15385 (U712_15795) comQ 3073862..3074761 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  U712_RS15390 (U712_15800) degQ 3074946..3075086 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  U712_RS21380 (U712_15805) - 3075308..3075433 (+) 126 WP_003228793.1 hypothetical protein -
  U712_RS15395 (U712_15810) - 3075547..3075915 (+) 369 WP_003243784.1 hypothetical protein -
  U712_RS15400 (U712_15815) pdeH 3075891..3077120 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  U712_RS15405 (U712_15820) pncB 3077257..3078729 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  U712_RS15410 (U712_15825) pncA 3078745..3079296 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  U712_RS15415 (U712_15830) yueI 3079393..3079791 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=52945 U712_RS15390 WP_003220708.1 3074946..3075086(-) (degQ) [Bacillus subtilis PY79]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=52945 U712_RS15390 WP_003220708.1 3074946..3075086(-) (degQ) [Bacillus subtilis PY79]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment