Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   JI723_RS14970 Genome accession   NZ_CP067099
Coordinates   3305290..3305421 (+) Length   43 a.a.
NCBI ID   WP_404826961.1    Uniprot ID   -
Organism   Providencia manganoxydans strain LLDRA6     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3300329..3314147 3305290..3305421 within 0


Gene organization within MGE regions


Location: 3300329..3314147
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JI723_RS14925 (JI723_14895) - 3300335..3300694 (-) 360 Protein_2934 terminase -
  JI723_RS14930 (JI723_14900) - 3300691..3301256 (-) 566 Protein_2935 terminase small subunit -
  JI723_RS14935 - 3301267..3301401 (-) 135 WP_319068709.1 hypothetical protein -
  JI723_RS14940 (JI723_14905) - 3301479..3301994 (-) 516 WP_140180788.1 lipocalin family protein -
  JI723_RS14945 (JI723_14910) - 3302169..3302621 (-) 453 WP_319068706.1 lysis protein -
  JI723_RS14950 (JI723_14915) - 3302618..3303046 (-) 429 WP_070929129.1 structural protein -
  JI723_RS14955 (JI723_14920) - 3303039..3303353 (-) 315 WP_272581371.1 phage holin family protein -
  JI723_RS14960 (JI723_14925) - 3303610..3304605 (-) 996 WP_272581373.1 YbgA family protein -
  JI723_RS14965 (JI723_14930) - 3305083..3305256 (-) 174 Protein_2942 antiterminator Q family protein -
  JI723_RS14970 ssb 3305290..3305421 (+) 132 WP_404826961.1 hypothetical protein Machinery gene
  JI723_RS14975 (JI723_14935) - 3305457..3305735 (+) 279 WP_337979539.1 hypothetical protein -
  JI723_RS14980 (JI723_14940) - 3305781..3305942 (+) 162 WP_154622819.1 hook protein -
  JI723_RS14985 (JI723_14945) - 3305979..3306176 (+) 198 WP_272581369.1 hypothetical protein -
  JI723_RS19945 (JI723_14950) - 3306179..3306634 (+) 456 Protein_2947 ASCH domain-containing protein -
  JI723_RS14995 (JI723_14955) - 3307249..3307530 (+) 282 WP_272581368.1 hypothetical protein -
  JI723_RS19950 - 3307706..3307870 (+) 165 WP_420704857.1 DUF7301 family protein -
  JI723_RS15000 (JI723_14960) - 3307867..3308031 (+) 165 WP_272581367.1 hypothetical protein -
  JI723_RS15005 (JI723_14965) - 3308024..3308263 (+) 240 WP_272581366.1 hypothetical protein -
  JI723_RS15010 (JI723_14970) - 3308256..3308591 (+) 336 WP_272581365.1 phage protein NinX family protein -
  JI723_RS15015 (JI723_14975) - 3308588..3308794 (+) 207 WP_272581364.1 hypothetical protein -
  JI723_RS15020 (JI723_14980) - 3309158..3309358 (+) 201 WP_272581362.1 hypothetical protein -
  JI723_RS15025 (JI723_14985) - 3309359..3309616 (+) 258 WP_337979540.1 excisionase -
  JI723_RS15030 (JI723_14990) - 3309573..3310637 (+) 1065 WP_272581360.1 tyrosine-type recombinase/integrase -
  JI723_RS15035 (JI723_14995) modE 3310695..3311480 (+) 786 WP_272581359.1 molybdenum-dependent transcriptional regulator -
  JI723_RS15040 (JI723_15000) modF 3311640..3313112 (+) 1473 WP_319068693.1 molybdate ABC transporter ATP-binding protein ModF -
  JI723_RS15045 (JI723_15005) - 3313317..3314147 (+) 831 WP_319068692.1 CPBP family intramembrane glutamic endopeptidase -

Sequence

Protein


Download         Length: 43 a.a.        Molecular weight: 4946.41 Da        Isoelectric Point: 4.1928

>NTDB_id=525061 JI723_RS14970 WP_404826961.1 3305290..3305421(+) (ssb) [Providencia manganoxydans strain LLDRA6]
MKFLDKKPQSTQQQSGWGQPQQPQQQAPQNEPPMDFSDSDIPF

Nucleotide


Download         Length: 132 bp        

>NTDB_id=525061 JI723_RS14970 WP_404826961.1 3305290..3305421(+) (ssb) [Providencia manganoxydans strain LLDRA6]
GTGAAGTTTCTAGACAAGAAACCACAGTCAACACAACAACAAAGTGGATGGGGACAGCCGCAACAACCGCAGCAACAAGC
GCCGCAGAATGAGCCACCGATGGACTTCAGTGATTCAGATATACCATTCTGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

57.778

100

0.605
  ssb Latilactobacillus sakei subsp. sakei 23K

39.024

95.349

0.372