Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilR   Type   Regulator
Locus tag   JH307_RS06230 Genome accession   NZ_CP066969
Coordinates   1385083..1386477 (-) Length   464 a.a.
NCBI ID   WP_070690014.1    Uniprot ID   -
Organism   Xanthomonas campestris strain 10-16     
Function   regulate pilin expression (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1301099..1398707 1385083..1386477 within 0


Gene organization within MGE regions


Location: 1301099..1398707
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JH307_RS05895 (JH307_05890) prpB 1302653..1303549 (+) 897 WP_011036231.1 methylisocitrate lyase -
  JH307_RS05900 (JH307_05895) prpC 1303625..1304779 (+) 1155 WP_011036232.1 2-methylcitrate synthase -
  JH307_RS05905 (JH307_05900) acnD 1304971..1307565 (+) 2595 WP_076039426.1 Fe/S-dependent 2-methylisocitrate dehydratase AcnD -
  JH307_RS05910 (JH307_05905) - 1307661..1307894 (+) 234 WP_016944831.1 type II toxin-antitoxin system ParD family antitoxin -
  JH307_RS05915 (JH307_05910) - 1307891..1308208 (+) 318 WP_076039425.1 type II toxin-antitoxin system RelE/ParE family toxin -
  JH307_RS05920 (JH307_05915) prpF 1308302..1309501 (+) 1200 WP_076039424.1 2-methylaconitate cis-trans isomerase PrpF -
  JH307_RS05925 (JH307_05920) - 1309756..1311972 (+) 2217 WP_070692164.1 TonB-dependent receptor -
  JH307_RS05930 (JH307_05925) - 1312046..1313047 (+) 1002 WP_197708511.1 nucleoside hydrolase -
  JH307_RS05935 (JH307_05930) - 1313815..1318731 (+) 4917 WP_274509556.1 alpha-2-macroglobulin -
  JH307_RS05940 (JH307_05935) - 1319089..1319556 (-) 468 WP_070692167.1 transposase -
  JH307_RS05945 (JH307_05940) - 1320328..1323414 (+) 3087 WP_274509805.1 TonB-dependent receptor -
  JH307_RS05950 (JH307_05945) - 1323518..1324465 (+) 948 WP_162277205.1 glycerophosphodiester phosphodiesterase family protein -
  JH307_RS05955 (JH307_05950) - 1324535..1325386 (+) 852 WP_337998745.1 CPBP family glutamic-type intramembrane protease -
  JH307_RS05960 (JH307_05955) pbpC 1325491..1327914 (+) 2424 WP_274509557.1 penicillin-binding protein 1C -
  JH307_RS05965 (JH307_05960) - 1328544..1329104 (-) 561 WP_076039417.1 ferritin-like domain-containing protein -
  JH307_RS05970 (JH307_05965) - 1329147..1329629 (-) 483 WP_014506917.1 peroxiredoxin -
  JH307_RS05975 (JH307_05970) - 1329790..1330266 (+) 477 WP_011036247.1 Hsp20/alpha crystallin family protein -
  JH307_RS05980 (JH307_05975) - 1330409..1331299 (+) 891 WP_014506919.1 DnaJ C-terminal domain-containing protein -
  JH307_RS05985 (JH307_05980) pilH 1331616..1332002 (+) 387 WP_011036249.1 twitching motility response regulator PilH -
  JH307_RS05990 (JH307_05985) hflK 1332934..1334076 (+) 1143 WP_014506921.1 FtsH protease activity modulator HflK -
  JH307_RS05995 (JH307_05990) - 1334076..1334939 (+) 864 WP_011036251.1 protease modulator HflC -
  JH307_RS06000 (JH307_05995) - 1335145..1335330 (+) 186 WP_076039416.1 DUF2065 family protein -
  JH307_RS06005 (JH307_06000) - 1335714..1337006 (+) 1293 WP_011036253.1 adenylosuccinate synthase -
  JH307_RS06010 (JH307_06005) - 1337174..1339846 (+) 2673 WP_274509558.1 M1 family metallopeptidase -
  JH307_RS06015 (JH307_06010) - 1339930..1340781 (+) 852 WP_274509559.1 hypothetical protein -
  JH307_RS06020 (JH307_06015) - 1340979..1341170 (-) 192 Protein_1146 XVIPCD domain-containing protein -
  JH307_RS06025 (JH307_06020) - 1341239..1342341 (+) 1103 Protein_1147 IS3-like element IS1404 family transposase -
  JH307_RS06030 (JH307_06025) - 1342378..1342605 (+) 228 Protein_1148 type IV secretory system conjugative DNA transfer family protein -
  JH307_RS06035 (JH307_06030) - 1342650..1343111 (+) 462 WP_043889145.1 hypothetical protein -
  JH307_RS06040 (JH307_06035) - 1343137..1343595 (+) 459 WP_084217866.1 hypothetical protein -
  JH307_RS06045 (JH307_06040) - 1343592..1347275 (+) 3684 WP_274509564.1 peptidoglycan-binding protein -
  JH307_RS06050 (JH307_06045) - 1347579..1348877 (+) 1299 WP_274509565.1 HlyD family efflux transporter periplasmic adaptor subunit -
  JH307_RS06055 (JH307_06050) - 1348874..1351087 (+) 2214 WP_274509566.1 peptidase domain-containing ABC transporter -
  JH307_RS06060 - 1351197..1351997 (+) 801 WP_228441325.1 hypothetical protein -
  JH307_RS06065 (JH307_06060) - 1352038..1352562 (+) 525 WP_274509567.1 hypothetical protein -
  JH307_RS06070 (JH307_06065) - 1352679..1353263 (+) 585 WP_274509568.1 hypothetical protein -
  JH307_RS06075 (JH307_06070) - 1353364..1354641 (-) 1278 WP_274509569.1 MFS transporter -
  JH307_RS06080 (JH307_06075) - 1354704..1355135 (-) 432 WP_274509570.1 toxin-activating lysine-acyltransferase -
  JH307_RS06085 (JH307_06080) - 1355125..1356939 (-) 1815 WP_274509571.1 protein adenylyltransferase SelO family protein -
  JH307_RS21720 - 1357461..1357997 (+) 537 Protein_1160 MobA/MobL family protein -
  JH307_RS21725 - 1357896..1358117 (-) 222 Protein_1161 hypothetical protein -
  JH307_RS06095 (JH307_06090) - 1359493..1359839 (+) 347 Protein_1162 DUF1629 domain-containing protein -
  JH307_RS06100 (JH307_06095) - 1360964..1361440 (-) 477 WP_274509573.1 Mov34/MPN/PAD-1 family protein -
  JH307_RS06105 (JH307_06100) - 1361428..1363062 (-) 1635 WP_274509574.1 ThiF family adenylyltransferase -
  JH307_RS06110 (JH307_06105) - 1363059..1364195 (-) 1137 WP_274509575.1 CBASS cGAMP synthase -
  JH307_RS06115 (JH307_06110) - 1364205..1365191 (-) 987 WP_274509576.1 CBASS cGAMP-activated phospholipase -
  JH307_RS06120 (JH307_06115) - 1365198..1365422 (-) 225 WP_274509577.1 DUF2188 domain-containing protein -
  JH307_RS06125 (JH307_06120) - 1365694..1366086 (+) 393 WP_274509578.1 helix-turn-helix transcriptional regulator -
  JH307_RS06130 (JH307_06125) - 1366089..1366958 (+) 870 WP_274509579.1 ImmA/IrrE family metallo-endopeptidase -
  JH307_RS06135 (JH307_06130) - 1367422..1367793 (+) 372 WP_076038482.1 hypothetical protein -
  JH307_RS06140 - 1367926..1368267 (+) 342 WP_228441887.1 hypothetical protein -
  JH307_RS06145 (JH307_06140) - 1368358..1368531 (+) 174 WP_228441890.1 hypothetical protein -
  JH307_RS06150 (JH307_06145) - 1368716..1369111 (+) 396 WP_011038225.1 hypothetical protein -
  JH307_RS06155 (JH307_06150) - 1369202..1369594 (+) 393 WP_076038484.1 H-NS family nucleoid-associated regulatory protein -
  JH307_RS06160 (JH307_06155) glgX 1370127..1372256 (-) 2130 WP_016945001.1 glycogen debranching protein GlgX -
  JH307_RS06165 (JH307_06160) rimK 1372749..1373624 (+) 876 WP_070689999.1 30S ribosomal protein S6--L-glutamate ligase -
  JH307_RS06170 (JH307_06165) - 1374274..1374951 (+) 678 WP_003490678.1 response regulator transcription factor -
  JH307_RS06175 (JH307_06170) - 1374944..1376278 (+) 1335 WP_019237347.1 HAMP domain-containing sensor histidine kinase -
  JH307_RS06180 (JH307_06175) - 1376421..1376912 (-) 492 WP_076038486.1 GNAT family N-acetyltransferase -
  JH307_RS06185 (JH307_06180) - 1376909..1377199 (-) 291 WP_011038219.1 DUF1778 domain-containing protein -
  JH307_RS06190 (JH307_06185) - 1377274..1377675 (-) 402 WP_274509580.1 SymE family type I addiction module toxin -
  JH307_RS06195 (JH307_06190) coaE 1378207..1378830 (-) 624 WP_076038488.1 dephospho-CoA kinase -
  JH307_RS06200 (JH307_06195) - 1378844..1379707 (-) 864 WP_040940797.1 A24 family peptidase -
  JH307_RS06205 (JH307_06200) pilC 1379714..1380970 (-) 1257 WP_076037882.1 type II secretion system F family protein Machinery gene
  JH307_RS06210 (JH307_06205) pilA/pilAI 1381314..1381721 (+) 408 WP_076038490.1 pilin Machinery gene
  JH307_RS06215 (JH307_06210) pilB 1381903..1383609 (+) 1707 WP_206419582.1 type IV-A pilus assembly ATPase PilB Machinery gene
  JH307_RS06220 (JH307_06215) - 1383792..1384529 (-) 738 WP_070690009.1 zeta toxin family protein -
  JH307_RS06225 (JH307_06220) - 1384529..1384891 (-) 363 WP_217694196.1 hypothetical protein -
  JH307_RS06230 (JH307_06225) pilR 1385083..1386477 (-) 1395 WP_070690014.1 sigma-54 dependent transcriptional regulator Regulator
  JH307_RS06235 (JH307_06230) - 1386686..1388296 (-) 1611 WP_014508702.1 HAMP domain-containing sensor histidine kinase -
  JH307_RS06240 (JH307_06235) sucC 1388530..1389699 (+) 1170 WP_011038209.1 ADP-forming succinate--CoA ligase subunit beta -
  JH307_RS06245 (JH307_06240) sucD 1389724..1390599 (+) 876 WP_011038208.1 succinate--CoA ligase subunit alpha -
  JH307_RS06250 (JH307_06245) - 1390703..1391113 (+) 411 WP_029628876.1 DNA-binding protein -
  JH307_RS06255 (JH307_06250) - 1391117..1391419 (+) 303 WP_011038207.1 type II toxin-antitoxin system RelE/ParE family toxin -
  JH307_RS06260 (JH307_06255) - 1391419..1393074 (+) 1656 WP_274509582.1 NAD+ synthase -
  JH307_RS06265 (JH307_06260) - 1393068..1394051 (-) 984 WP_274509583.1 hypothetical protein -
  JH307_RS06270 (JH307_06265) - 1394502..1395383 (-) 882 WP_011038204.1 outer membrane protein assembly factor BamD -
  JH307_RS06275 (JH307_06270) rluD 1395506..1396501 (+) 996 WP_076038496.1 23S rRNA pseudouridine(1911/1915/1917) synthase RluD -
  JH307_RS06280 (JH307_06275) pgeF 1396503..1397303 (+) 801 WP_274509584.1 peptidoglycan editing factor PgeF -
  JH307_RS06285 (JH307_06280) - 1397324..1397830 (+) 507 WP_076037045.1 DUF4166 domain-containing protein -
  JH307_RS06290 (JH307_06285) - 1397817..1398236 (+) 420 WP_011038200.1 thiol-disulfide oxidoreductase DCC family protein -

Sequence


Protein


Download         Length: 464 a.a.        Molecular weight: 50265.64 Da        Isoelectric Point: 6.3588

>NTDB_id=523700 JH307_RS06230 WP_070690014.1 1385083..1386477(-) (pilR) [Xanthomonas campestris strain 10-16]
MNETKSALVVDDERDIRELLVLTLGRMGLRISTAANLAEARELLASNPYDLCLTDMRLPDGNGIELVTEIARQYPQTPVA
MITAFGSMDLAVEALKAGAFDFVSKPVDISVLRGLVKHALELNNRDRPAPPPPPPEQASRLLGDSTAMESLRSTIGKVAR
SQAPVYIVGESGVGKELVARTIHEQGARAAGPFIPVNCGAIPAELMESEFFGHKKGSFTGAHADKPGLFQAAHGGTLFLD
EVAELPLQMQVKLLRAIQEKSVRPVGASGETLVDVRILSATHKDLGDLVSDGRFRHDLYYRINVIELRVPPLRERSGDLP
QLAAAIIARLARSHGRPIPLLTQSALDALDTYGFPGNVRELENILERALALAEDDQISASDLRLPAHGGHRLAASPGSAA
IEPREAVVDIDPASAALPSYIEQLERAAIQKALEENRWNKTRTAAQLGITFRALRYKLKKLGME

Nucleotide


Download         Length: 1395 bp        

>NTDB_id=523700 JH307_RS06230 WP_070690014.1 1385083..1386477(-) (pilR) [Xanthomonas campestris strain 10-16]
ATGAACGAAACGAAAAGTGCCCTGGTCGTCGATGACGAGCGTGACATCCGCGAACTGCTTGTTCTCACCCTGGGCCGCAT
GGGGCTGCGCATCAGCACCGCCGCCAACCTGGCCGAAGCACGCGAATTGCTGGCCAGCAACCCGTACGACCTGTGCCTGA
CCGACATGCGGTTGCCCGACGGCAACGGCATCGAGCTGGTGACCGAGATCGCGCGCCAATACCCGCAGACGCCGGTGGCC
ATGATCACCGCGTTCGGCAGCATGGACCTGGCGGTGGAAGCGCTGAAAGCCGGCGCGTTCGACTTCGTCAGCAAGCCGGT
GGACATCAGCGTGCTGCGTGGCCTGGTCAAGCACGCACTGGAATTGAACAACCGCGACCGGCCGGCGCCGCCACCGCCCC
CGCCGGAACAGGCCAGCCGCCTGCTCGGCGATTCGACCGCCATGGAGAGCCTGCGCTCCACCATCGGCAAGGTCGCGCGC
AGCCAGGCGCCGGTCTACATCGTCGGCGAATCCGGCGTGGGCAAGGAACTGGTGGCCCGCACCATCCACGAGCAGGGCGC
GCGCGCGGCCGGGCCGTTCATTCCAGTCAACTGCGGCGCGATCCCGGCCGAGCTGATGGAGAGCGAGTTCTTCGGCCATA
AGAAGGGCAGCTTTACCGGCGCGCATGCCGACAAGCCGGGCCTGTTTCAGGCCGCGCATGGCGGCACGCTGTTTCTGGAC
GAAGTGGCCGAGCTGCCGCTGCAGATGCAGGTCAAGCTGCTGCGCGCCATCCAGGAAAAATCGGTGCGCCCGGTCGGCGC
GTCGGGCGAAACGCTGGTGGACGTGCGCATTCTGTCGGCCACGCACAAGGACCTGGGCGACCTGGTCTCCGACGGCCGCT
TTCGTCACGACCTGTATTACCGCATCAACGTGATCGAACTCCGTGTGCCACCGCTGCGCGAGCGCAGTGGCGACCTGCCG
CAACTGGCCGCCGCCATCATTGCGCGGCTGGCCCGCAGCCATGGCCGCCCGATTCCGCTGCTGACCCAGTCAGCCCTGGA
TGCATTGGATACTTACGGCTTTCCGGGCAACGTGCGCGAACTGGAAAACATCCTCGAACGCGCCCTGGCCCTGGCCGAAG
ACGACCAGATCAGCGCCAGCGATCTGCGCCTACCCGCCCACGGCGGCCACCGCCTCGCCGCCAGCCCCGGCAGCGCCGCC
ATCGAACCGCGCGAAGCCGTGGTCGACATCGATCCCGCCTCGGCCGCCCTGCCCTCTTACATCGAACAACTGGAACGCGC
CGCGATCCAGAAGGCGCTGGAAGAAAACCGGTGGAACAAGACCAGAACTGCCGCGCAGCTAGGCATCACGTTTCGTGCGC
TGCGCTACAAGCTCAAGAAATTGGGGATGGAGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilR Pseudomonas aeruginosa PAK

63.067

99.784

0.629

  pilR Acinetobacter baumannii strain A118

49.138

100

0.491