Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   JEQ22_RS12145 Genome accession   NZ_CP066501
Coordinates   2485907..2486080 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain ID-A02     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2480907..2491080
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ22_RS12130 (JEQ22_12055) gcvT 2481720..2482820 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  JEQ22_RS12135 (JEQ22_12060) - 2483244..2484914 (+) 1671 WP_017418135.1 SNF2-related protein -
  JEQ22_RS12140 (JEQ22_12065) - 2484936..2485730 (+) 795 WP_014305407.1 YqhG family protein -
  JEQ22_RS12145 (JEQ22_12070) sinI 2485907..2486080 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  JEQ22_RS12150 (JEQ22_12075) sinR 2486114..2486449 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JEQ22_RS12155 (JEQ22_12080) - 2486497..2487282 (-) 786 WP_017418136.1 TasA family protein -
  JEQ22_RS12160 (JEQ22_12085) - 2487347..2487931 (-) 585 WP_012117977.1 signal peptidase I -
  JEQ22_RS12165 (JEQ22_12090) tapA 2487903..2488574 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  JEQ22_RS12170 (JEQ22_12095) - 2488833..2489162 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  JEQ22_RS12175 (JEQ22_12100) - 2489203..2489382 (-) 180 WP_003153093.1 YqzE family protein -
  JEQ22_RS12180 (JEQ22_12105) comGG 2489439..2489816 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  JEQ22_RS12185 (JEQ22_12110) comGF 2489817..2490212 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  JEQ22_RS12190 (JEQ22_12115) comGE 2490226..2490540 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  JEQ22_RS12195 (JEQ22_12120) comGD 2490524..2490961 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=520530 JEQ22_RS12145 WP_014418369.1 2485907..2486080(+) (sinI) [Bacillus velezensis strain ID-A02]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=520530 JEQ22_RS12145 WP_014418369.1 2485907..2486080(+) (sinI) [Bacillus velezensis strain ID-A02]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719