Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | JEQ22_RS12145 | Genome accession | NZ_CP066501 |
| Coordinates | 2485907..2486080 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain ID-A02 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2480907..2491080
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JEQ22_RS12130 (JEQ22_12055) | gcvT | 2481720..2482820 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| JEQ22_RS12135 (JEQ22_12060) | - | 2483244..2484914 (+) | 1671 | WP_017418135.1 | SNF2-related protein | - |
| JEQ22_RS12140 (JEQ22_12065) | - | 2484936..2485730 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| JEQ22_RS12145 (JEQ22_12070) | sinI | 2485907..2486080 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| JEQ22_RS12150 (JEQ22_12075) | sinR | 2486114..2486449 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| JEQ22_RS12155 (JEQ22_12080) | - | 2486497..2487282 (-) | 786 | WP_017418136.1 | TasA family protein | - |
| JEQ22_RS12160 (JEQ22_12085) | - | 2487347..2487931 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| JEQ22_RS12165 (JEQ22_12090) | tapA | 2487903..2488574 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| JEQ22_RS12170 (JEQ22_12095) | - | 2488833..2489162 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| JEQ22_RS12175 (JEQ22_12100) | - | 2489203..2489382 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| JEQ22_RS12180 (JEQ22_12105) | comGG | 2489439..2489816 (-) | 378 | WP_025649851.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| JEQ22_RS12185 (JEQ22_12110) | comGF | 2489817..2490212 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| JEQ22_RS12190 (JEQ22_12115) | comGE | 2490226..2490540 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| JEQ22_RS12195 (JEQ22_12120) | comGD | 2490524..2490961 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=520530 JEQ22_RS12145 WP_014418369.1 2485907..2486080(+) (sinI) [Bacillus velezensis strain ID-A02]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=520530 JEQ22_RS12145 WP_014418369.1 2485907..2486080(+) (sinI) [Bacillus velezensis strain ID-A02]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |