Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   JEQ22_RS12190 Genome accession   NZ_CP066501
Coordinates   2490226..2490540 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain ID-A02     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2485226..2495540
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ22_RS12145 (JEQ22_12070) sinI 2485907..2486080 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  JEQ22_RS12150 (JEQ22_12075) sinR 2486114..2486449 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JEQ22_RS12155 (JEQ22_12080) - 2486497..2487282 (-) 786 WP_017418136.1 TasA family protein -
  JEQ22_RS12160 (JEQ22_12085) - 2487347..2487931 (-) 585 WP_012117977.1 signal peptidase I -
  JEQ22_RS12165 (JEQ22_12090) tapA 2487903..2488574 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  JEQ22_RS12170 (JEQ22_12095) - 2488833..2489162 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  JEQ22_RS12175 (JEQ22_12100) - 2489203..2489382 (-) 180 WP_003153093.1 YqzE family protein -
  JEQ22_RS12180 (JEQ22_12105) comGG 2489439..2489816 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  JEQ22_RS12185 (JEQ22_12110) comGF 2489817..2490212 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  JEQ22_RS12190 (JEQ22_12115) comGE 2490226..2490540 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  JEQ22_RS12195 (JEQ22_12120) comGD 2490524..2490961 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  JEQ22_RS12200 (JEQ22_12125) comGC 2490951..2491259 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  JEQ22_RS12205 (JEQ22_12130) comGB 2491264..2492301 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  JEQ22_RS12210 (JEQ22_12135) comGA 2492288..2493358 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  JEQ22_RS12215 (JEQ22_12140) - 2493551..2494501 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=520533 JEQ22_RS12190 WP_017418140.1 2490226..2490540(-) (comGE) [Bacillus velezensis strain ID-A02]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=520533 JEQ22_RS12190 WP_017418140.1 2490226..2490540(-) (comGE) [Bacillus velezensis strain ID-A02]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481