Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JEQ16_RS14855 Genome accession   NZ_CP066377
Coordinates   3006904..3007044 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain ID-A01     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3001904..3012044
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ16_RS14830 (JEQ16_14735) - 3002231..3002614 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  JEQ16_RS14835 (JEQ16_14740) comA 3002636..3003280 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  JEQ16_RS14840 (JEQ16_14745) comP 3003361..3005667 (-) 2307 WP_153986739.1 sensor histidine kinase Regulator
  JEQ16_RS14845 (JEQ16_14750) comX 3005686..3005862 (-) 177 WP_278071273.1 competence pheromone ComX -
  JEQ16_RS14850 (JEQ16_14755) - 3005877..3006752 (-) 876 WP_146277410.1 polyprenyl synthetase family protein -
  JEQ16_RS14855 (JEQ16_14760) degQ 3006904..3007044 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  JEQ16_RS14860 (JEQ16_14765) - 3007411..3007752 (+) 342 WP_278071274.1 hypothetical protein -
  JEQ16_RS14865 (JEQ16_14770) - 3007759..3008979 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  JEQ16_RS14870 (JEQ16_14775) - 3009109..3010575 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  JEQ16_RS14875 (JEQ16_14780) - 3010593..3011144 (-) 552 WP_278071275.1 isochorismatase family cysteine hydrolase -
  JEQ16_RS14880 (JEQ16_14785) - 3011241..3011639 (-) 399 WP_278071276.1 YueI family protein -
  JEQ16_RS14885 (JEQ16_14790) - 3011705..3011953 (-) 249 WP_003152028.1 YueH family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=519615 JEQ16_RS14855 WP_003152043.1 3006904..3007044(-) (degQ) [Bacillus velezensis strain ID-A01]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=519615 JEQ16_RS14855 WP_003152043.1 3006904..3007044(-) (degQ) [Bacillus velezensis strain ID-A01]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891