Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   JEQ16_RS01960 Genome accession   NZ_CP066377
Coordinates   384336..384455 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain ID-A01     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 379336..389455
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ16_RS01945 (JEQ16_01935) - 380948..381631 (+) 684 WP_014416901.1 response regulator transcription factor -
  JEQ16_RS01950 (JEQ16_01940) - 381618..383051 (+) 1434 WP_278071569.1 HAMP domain-containing sensor histidine kinase -
  JEQ16_RS01955 (JEQ16_01945) rapC 383204..384352 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  JEQ16_RS01960 (JEQ16_01950) phrC 384336..384455 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  JEQ16_RS01965 (JEQ16_01955) - 384604..384699 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  JEQ16_RS01970 (JEQ16_01960) - 384794..386158 (-) 1365 WP_070081361.1 aspartate kinase -
  JEQ16_RS01975 (JEQ16_01965) ceuB 386573..387526 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  JEQ16_RS01980 (JEQ16_01970) - 387516..388463 (+) 948 WP_278071570.1 iron chelate uptake ABC transporter family permease subunit -
  JEQ16_RS01985 (JEQ16_01975) - 388457..389215 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=519563 JEQ16_RS01960 WP_003156334.1 384336..384455(+) (phrC) [Bacillus velezensis strain ID-A01]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=519563 JEQ16_RS01960 WP_003156334.1 384336..384455(+) (phrC) [Bacillus velezensis strain ID-A01]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
CCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718