Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   JFU10_RS03200 Genome accession   NZ_CP066337
Coordinates   751711..752148 (-) Length   145 a.a.
NCBI ID   WP_044053464.1    Uniprot ID   -
Organism   Bacillus velezensis strain Mr12     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 746711..757148
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JFU10_RS03150 sinI 747096..747269 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  JFU10_RS03155 sinR 747303..747638 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JFU10_RS03160 tasA 747686..748471 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  JFU10_RS03165 sipW 748535..749119 (-) 585 WP_060562614.1 signal peptidase I SipW -
  JFU10_RS03170 tapA 749091..749762 (-) 672 WP_071391613.1 amyloid fiber anchoring/assembly protein TapA -
  JFU10_RS03175 - 750021..750350 (+) 330 WP_071391612.1 DUF3889 domain-containing protein -
  JFU10_RS03180 - 750390..750569 (-) 180 WP_003153093.1 YqzE family protein -
  JFU10_RS03185 comGG 750626..751003 (-) 378 WP_071391611.1 competence type IV pilus minor pilin ComGG Machinery gene
  JFU10_RS03190 comGF 751004..751504 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  JFU10_RS03195 comGE 751413..751727 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  JFU10_RS03200 comGD 751711..752148 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  JFU10_RS03205 comGC 752138..752446 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  JFU10_RS03210 comGB 752451..753488 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  JFU10_RS03215 comGA 753475..754545 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  JFU10_RS03220 - 754736..755686 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -
  JFU10_RS03225 - 755832..757133 (+) 1302 WP_070082114.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16282.81 Da        Isoelectric Point: 10.3354

>NTDB_id=519297 JFU10_RS03200 WP_044053464.1 751711..752148(-) (comGD) [Bacillus velezensis strain Mr12]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=519297 JFU10_RS03200 WP_044053464.1 751711..752148(-) (comGD) [Bacillus velezensis strain Mr12]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCACTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566