Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   JFU10_RS03150 Genome accession   NZ_CP066337
Coordinates   747096..747269 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Mr12     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 742096..752269
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JFU10_RS03135 gcvT 742913..744013 (-) 1101 WP_071391617.1 glycine cleavage system aminomethyltransferase GcvT -
  JFU10_RS03140 - 744437..746107 (+) 1671 WP_046559872.1 DEAD/DEAH box helicase -
  JFU10_RS03145 - 746125..746919 (+) 795 WP_071391615.1 YqhG family protein -
  JFU10_RS03150 sinI 747096..747269 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  JFU10_RS03155 sinR 747303..747638 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JFU10_RS03160 tasA 747686..748471 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  JFU10_RS03165 sipW 748535..749119 (-) 585 WP_060562614.1 signal peptidase I SipW -
  JFU10_RS03170 tapA 749091..749762 (-) 672 WP_071391613.1 amyloid fiber anchoring/assembly protein TapA -
  JFU10_RS03175 - 750021..750350 (+) 330 WP_071391612.1 DUF3889 domain-containing protein -
  JFU10_RS03180 - 750390..750569 (-) 180 WP_003153093.1 YqzE family protein -
  JFU10_RS03185 comGG 750626..751003 (-) 378 WP_071391611.1 competence type IV pilus minor pilin ComGG Machinery gene
  JFU10_RS03190 comGF 751004..751504 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  JFU10_RS03195 comGE 751413..751727 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  JFU10_RS03200 comGD 751711..752148 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=519293 JFU10_RS03150 WP_003153105.1 747096..747269(+) (sinI) [Bacillus velezensis strain Mr12]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=519293 JFU10_RS03150 WP_003153105.1 747096..747269(+) (sinI) [Bacillus velezensis strain Mr12]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702