Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JD965_RS15455 Genome accession   NZ_CP066219
Coordinates   3028883..3029023 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus siamensis strain B28     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3023883..3034023
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JD965_RS15430 (JD965_15430) - 3024223..3024606 (-) 384 WP_016938118.1 hotdog fold thioesterase -
  JD965_RS15435 (JD965_15435) comA 3024628..3025272 (-) 645 WP_047476983.1 response regulator transcription factor Regulator
  JD965_RS15440 (JD965_15440) comP 3025353..3027644 (-) 2292 WP_016938116.1 histidine kinase Regulator
  JD965_RS15445 (JD965_15445) comX 3027656..3027820 (-) 165 WP_007613432.1 competence pheromone ComX -
  JD965_RS15450 (JD965_15450) - 3027820..3028731 (-) 912 WP_029575319.1 polyprenyl synthetase family protein -
  JD965_RS15455 (JD965_15455) degQ 3028883..3029023 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  JD965_RS15460 (JD965_15460) - 3029489..3029830 (+) 342 WP_049627267.1 hypothetical protein -
  JD965_RS15465 (JD965_15465) - 3029835..3031058 (-) 1224 WP_198698074.1 EAL and HDOD domain-containing protein -
  JD965_RS15470 (JD965_15470) - 3031188..3032654 (-) 1467 WP_095241408.1 nicotinate phosphoribosyltransferase -
  JD965_RS15475 (JD965_15475) - 3032672..3033223 (-) 552 WP_198698075.1 cysteine hydrolase family protein -
  JD965_RS15480 (JD965_15480) - 3033315..3033710 (-) 396 Protein_3019 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=518530 JD965_RS15455 WP_013353398.1 3028883..3029023(-) (degQ) [Bacillus siamensis strain B28]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=518530 JD965_RS15455 WP_013353398.1 3028883..3029023(-) (degQ) [Bacillus siamensis strain B28]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCTTTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913