Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGA   Type   Machinery gene
Locus tag   JC776_RS13905 Genome accession   NZ_CP066194
Coordinates   2741577..2742215 (+) Length   212 a.a.
NCBI ID   WP_265183406.1    Uniprot ID   -
Organism   Bacillus cytotoxicus strain E8.1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2705933..2750302 2741577..2742215 within 0


Gene organization within MGE regions


Location: 2705933..2750302
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JC776_RS13630 (JC776_13630) - 2705933..2707357 (-) 1425 WP_012095429.1 recombinase family protein -
  JC776_RS13635 (JC776_13635) - 2707371..2707796 (-) 426 WP_012095428.1 ImmA/IrrE family metallo-endopeptidase -
  JC776_RS13640 (JC776_13640) - 2707811..2708233 (-) 423 WP_048723893.1 helix-turn-helix transcriptional regulator -
  JC776_RS13645 (JC776_13645) - 2708506..2708694 (+) 189 WP_012095426.1 helix-turn-helix transcriptional regulator -
  JC776_RS22175 - 2708691..2709467 (+) 777 WP_048723896.1 ORF6C domain-containing protein -
  JC776_RS13660 (JC776_13660) - 2709496..2709690 (+) 195 WP_048723899.1 hypothetical protein -
  JC776_RS13665 (JC776_13665) - 2709719..2709862 (+) 144 WP_157671227.1 hypothetical protein -
  JC776_RS13670 (JC776_13670) - 2710010..2710276 (+) 267 WP_012095422.1 hypothetical protein -
  JC776_RS13675 (JC776_13675) - 2710299..2710667 (+) 369 WP_012095421.1 helix-turn-helix transcriptional regulator -
  JC776_RS13680 (JC776_13680) - 2710731..2711213 (+) 483 WP_012095420.1 siphovirus Gp157 family protein -
  JC776_RS13685 (JC776_13685) - 2711210..2711881 (+) 672 WP_012095419.1 DUF1071 domain-containing protein -
  JC776_RS13690 (JC776_13690) - 2711895..2712164 (+) 270 WP_012095418.1 hypothetical protein -
  JC776_RS13695 (JC776_13695) - 2712165..2712968 (+) 804 WP_048723901.1 conserved phage C-terminal domain-containing protein -
  JC776_RS13700 (JC776_13700) - 2712898..2713770 (+) 873 WP_053083802.1 ATP-binding protein -
  JC776_RS13705 (JC776_13705) - 2713781..2714008 (+) 228 WP_048723903.1 hypothetical protein -
  JC776_RS13710 (JC776_13710) - 2713977..2714159 (+) 183 WP_162533109.1 hypothetical protein -
  JC776_RS13715 (JC776_13715) - 2714161..2714952 (+) 792 WP_094398390.1 hypothetical protein -
  JC776_RS13720 (JC776_13720) - 2715106..2715678 (+) 573 WP_048723936.1 dUTP diphosphatase -
  JC776_RS13725 (JC776_13725) - 2715715..2715915 (+) 201 WP_048723905.1 hypothetical protein -
  JC776_RS13730 (JC776_13730) - 2715994..2716200 (+) 207 WP_048723907.1 hypothetical protein -
  JC776_RS13735 (JC776_13735) - 2716243..2716776 (+) 534 WP_048723909.1 hypothetical protein -
  JC776_RS13740 (JC776_13740) - 2717031..2717462 (+) 432 WP_048723912.1 hypothetical protein -
  JC776_RS13745 (JC776_13745) - 2717523..2717732 (-) 210 WP_048723913.1 hypothetical protein -
  JC776_RS13750 (JC776_13750) - 2717833..2718117 (+) 285 WP_012095411.1 hypothetical protein -
  JC776_RS13755 (JC776_13755) - 2718136..2718282 (+) 147 WP_157671228.1 hypothetical protein -
  JC776_RS13760 (JC776_13760) - 2718369..2718620 (+) 252 WP_048723938.1 helix-turn-helix transcriptional regulator -
  JC776_RS13765 (JC776_13765) - 2718636..2718776 (+) 141 WP_157671229.1 hypothetical protein -
  JC776_RS13770 (JC776_13770) - 2718790..2718957 (+) 168 WP_164468645.1 hypothetical protein -
  JC776_RS13775 (JC776_13775) - 2719000..2719287 (+) 288 WP_048723916.1 hypothetical protein -
  JC776_RS13780 (JC776_13780) - 2719292..2719672 (+) 381 WP_048723918.1 ArpU family transcriptional regulator -
  JC776_RS13785 (JC776_13785) - 2719675..2719842 (+) 168 WP_157671230.1 hypothetical protein -
  JC776_RS13790 (JC776_13790) - 2719912..2720079 (+) 168 WP_164468646.1 hypothetical protein -
  JC776_RS13795 (JC776_13795) - 2720076..2720321 (+) 246 WP_048723940.1 helix-turn-helix domain-containing protein -
  JC776_RS13800 (JC776_13800) - 2721085..2721516 (+) 432 WP_048723920.1 terminase small subunit -
  JC776_RS13805 (JC776_13805) - 2721509..2722807 (+) 1299 WP_041810558.1 PBSX family phage terminase large subunit -
  JC776_RS13810 (JC776_13810) - 2722819..2724174 (+) 1356 WP_012095405.1 phage portal protein -
  JC776_RS13815 (JC776_13815) - 2724161..2725186 (+) 1026 WP_012095404.1 minor capsid protein -
  JC776_RS13820 (JC776_13820) - 2725256..2725846 (+) 591 WP_012095403.1 DUF4355 domain-containing protein -
  JC776_RS13825 (JC776_13825) - 2725860..2726702 (+) 843 WP_012095402.1 hypothetical protein -
  JC776_RS13830 (JC776_13830) - 2726739..2727077 (+) 339 WP_012095401.1 head-tail connector protein -
  JC776_RS13835 (JC776_13835) - 2727059..2727418 (+) 360 WP_012095400.1 hypothetical protein -
  JC776_RS13840 (JC776_13840) - 2727402..2727818 (+) 417 WP_012095399.1 hypothetical protein -
  JC776_RS13845 (JC776_13845) - 2727815..2728195 (+) 381 WP_048723923.1 hypothetical protein -
  JC776_RS13850 (JC776_13850) - 2728213..2728845 (+) 633 WP_048723925.1 hypothetical protein -
  JC776_RS13855 (JC776_13855) - 2728891..2729328 (+) 438 WP_012095396.1 hypothetical protein -
  JC776_RS13860 (JC776_13860) - 2729433..2729630 (+) 198 WP_235436463.1 hypothetical protein -
  JC776_RS13865 (JC776_13865) - 2729636..2732563 (+) 2928 WP_012095394.1 phage tail tape measure protein -
  JC776_RS13870 (JC776_13870) - 2732576..2734069 (+) 1494 WP_210370715.1 distal tail protein Dit -
  JC776_RS13875 (JC776_13875) - 2734070..2738563 (+) 4494 WP_053083799.1 phage tail spike protein -
  JC776_RS13880 (JC776_13880) - 2738598..2739038 (+) 441 WP_012095391.1 phage holin family protein -
  JC776_RS13885 (JC776_13885) - 2739038..2739859 (+) 822 WP_012095390.1 GH25 family lysozyme -
  JC776_RS13890 (JC776_13890) - 2739934..2740374 (-) 441 WP_012095389.1 hypothetical protein -
  JC776_RS13895 (JC776_13895) - 2740685..2741257 (-) 573 WP_012095388.1 DUF4352 domain-containing protein -
  JC776_RS13900 (JC776_13900) - 2741374..2741538 (-) 165 WP_164468640.1 hypothetical protein -
  JC776_RS13905 (JC776_13905) comGA 2741577..2742215 (+) 639 WP_265183406.1 ATPase, T2SS/T4P/T4SS family Machinery gene
  JC776_RS13910 (JC776_13910) comGB 2742202..2743242 (+) 1041 WP_041810011.1 competence type IV pilus assembly protein ComGB -
  JC776_RS13915 (JC776_13915) comGC 2743255..2743554 (+) 300 WP_012095385.1 competence type IV pilus major pilin ComGC -
  JC776_RS13920 (JC776_13920) comGD 2743551..2743997 (+) 447 Protein_2677 competence type IV pilus minor pilin ComGD -
  JC776_RS22180 - 2743975..2744292 (+) 318 WP_235436438.1 type II secretion system protein -
  JC776_RS13925 (JC776_13925) comGF 2744271..2744741 (+) 471 WP_041810544.1 competence type IV pilus minor pilin ComGF -
  JC776_RS13930 (JC776_13930) comGG 2744738..2745112 (+) 375 WP_048723614.1 competence type IV pilus minor pilin ComGG -
  JC776_RS13935 (JC776_13935) - 2745512..2746009 (+) 498 WP_012095381.1 shikimate kinase -
  JC776_RS13940 (JC776_13940) - 2746048..2746248 (+) 201 WP_048723620.1 YqzE family protein -
  JC776_RS13945 (JC776_13945) - 2746394..2747023 (-) 630 WP_012095379.1 VC0807 family protein -
  JC776_RS13950 (JC776_13950) - 2747342..2747569 (+) 228 WP_012095378.1 hypothetical protein -
  JC776_RS13955 (JC776_13955) - 2747659..2747805 (+) 147 WP_012095377.1 hypothetical protein -
  JC776_RS13960 (JC776_13960) - 2747839..2748633 (-) 795 WP_012095376.1 YqhG family protein -
  JC776_RS13965 (JC776_13965) - 2748620..2750302 (-) 1683 WP_087095342.1 SNF2-related protein -

Sequence


Protein


Download         Length: 212 a.a.        Molecular weight: 23775.70 Da        Isoelectric Point: 9.4652

>NTDB_id=518408 JC776_RS13905 WP_265183406.1 2741577..2742215(+) (comGA) [Bacillus cytotoxicus strain E8.1]
MRSCIYVTKTTGSGKTTTMYALLEVAKKGQTRRIVTLEDPVEKRKNGLLQIQINEKAGITYETGLKAILRHDPDIILVGE
IRDEETAKVAVRASLTGHLVMTTLHTNDAKGAVLRLMDFGISRQEIEQSLLAVAAQRLVELKCPFCKGKCSPLCKSIRQV
RQASIYELLYGHELKKAIREANGERVVYRYETLQSSLKKGYALGFLEEDVYV

Nucleotide


Download         Length: 639 bp        

>NTDB_id=518408 JC776_RS13905 WP_265183406.1 2741577..2742215(+) (comGA) [Bacillus cytotoxicus strain E8.1]
ATTCGGAGTTGTATTTATGTTACTAAAACAACTGGATCTGGAAAAACAACAACAATGTATGCGTTATTAGAAGTTGCCAA
AAAAGGTCAAACACGCCGGATTGTTACATTGGAAGATCCGGTGGAGAAAAGAAAGAACGGTTTATTACAAATTCAAATTA
ATGAAAAAGCAGGGATTACGTATGAGACAGGTTTAAAGGCAATTTTACGGCATGACCCAGATATTATTTTAGTGGGGGAA
ATTCGTGATGAAGAAACAGCAAAAGTGGCTGTACGTGCAAGTTTAACAGGTCATTTAGTAATGACAACGCTGCATACAAA
TGATGCGAAAGGTGCTGTATTGCGCTTGATGGATTTTGGAATTAGCAGACAGGAAATTGAACAGTCGTTATTAGCTGTAG
CCGCTCAGCGCCTTGTAGAGTTGAAATGTCCGTTTTGTAAAGGGAAGTGTTCACCATTATGTAAATCGATACGCCAAGTA
CGGCAAGCAAGCATTTATGAGTTGCTATATGGTCATGAATTGAAGAAAGCCATTCGCGAAGCGAATGGCGAACGTGTGGT
GTATCGCTATGAAACATTACAATCTTCATTAAAGAAAGGCTATGCTTTAGGATTTTTAGAAGAGGATGTTTATGTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGA Bacillus subtilis subsp. subtilis str. 168

60

96.698

0.58

  pilB Vibrio campbellii strain DS40M4

37.383

100

0.377

  pilB Haemophilus influenzae 86-028NP

46.471

80.189

0.373