Detailed information
Overview
| Name | comS | Type | Regulator |
| Locus tag | I6H74_RS01310 | Genome accession | NZ_CP066069 |
| Coordinates | 248893..248988 (-) | Length | 31 a.a. |
| NCBI ID | WP_198455558.1 | Uniprot ID | - |
| Organism | Streptococcus dysgalactiae strain FDAARGOS_1017 | ||
| Function | activate transcription of comX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 249075..261464 | 248893..248988 | flank | 87 |
Gene organization within MGE regions
Location: 248893..261464
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6H74_RS01310 | comS | 248893..248988 (-) | 96 | WP_198455558.1 | quorum-sensing system DWW-type pheromone | Regulator |
| I6H74_RS01315 (I6H74_01310) | comR | 249075..249986 (-) | 912 | WP_115256701.1 | XRE family transcriptional regulator | Regulator |
| I6H74_RS01320 (I6H74_01315) | purB | 250128..251420 (-) | 1293 | WP_022554088.1 | adenylosuccinate lyase | - |
| I6H74_RS01325 (I6H74_01320) | - | 251605..253464 (-) | 1860 | WP_015016520.1 | DUF262 domain-containing protein | - |
| I6H74_RS01330 (I6H74_01325) | purK | 253483..254556 (-) | 1074 | WP_115256700.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
| I6H74_RS01335 (I6H74_01330) | purE | 254543..255031 (-) | 489 | WP_046177508.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| I6H74_RS01340 (I6H74_01335) | - | 255462..256325 (+) | 864 | WP_046177583.1 | IS982 family transposase | - |
| I6H74_RS01345 (I6H74_01340) | purD | 256636..257898 (-) | 1263 | WP_046177522.1 | phosphoribosylamine--glycine ligase | - |
| I6H74_RS01350 (I6H74_01345) | - | 258182..259309 (+) | 1128 | WP_003055557.1 | SH3 domain-containing protein | - |
| I6H74_RS01355 (I6H74_01350) | purH | 259389..260933 (-) | 1545 | WP_046177523.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
| I6H74_RS01360 (I6H74_01355) | - | 260952..261464 (-) | 513 | WP_015057184.1 | VanZ family protein | - |
Sequence
Protein
Download Length: 31 a.a. Molecular weight: 3929.72 Da Isoelectric Point: 10.1669
>NTDB_id=517082 I6H74_RS01310 WP_198455558.1 248893..248988(-) (comS) [Streptococcus dysgalactiae strain FDAARGOS_1017]
MFKRYHYYFILTAMLAFKAAQMISQVDWWRL
MFKRYHYYFILTAMLAFKAAQMISQVDWWRL
Nucleotide
Download Length: 96 bp
>NTDB_id=517082 I6H74_RS01310 WP_198455558.1 248893..248988(-) (comS) [Streptococcus dysgalactiae strain FDAARGOS_1017]
ATGTTCAAAAGATATCACTACTATTTTATACTTACTGCTATGTTAGCATTTAAAGCAGCTCAGATGATAAGTCAAGTGGA
TTGGTGGCGTTTGTAA
ATGTTCAAAAGATATCACTACTATTTTATACTTACTGCTATGTTAGCATTTAAAGCAGCTCAGATGATAAGTCAAGTGGA
TTGGTGGCGTTTGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comS | Streptococcus pyogenes MGAS8232 |
61.29 |
100 |
0.613 |
| comS | Streptococcus pyogenes MGAS315 |
38.71 |
100 |
0.387 |