Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   JAV55_RS16475 Genome accession   NZ_CP065943
Coordinates   3191212..3191352 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain H2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3186212..3196352
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JAV55_RS16450 (JAV55_16450) - 3186509..3186898 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  JAV55_RS16455 (JAV55_16455) comA 3186915..3187553 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  JAV55_RS16460 (JAV55_16460) comP 3187640..3189946 (-) 2307 WP_003184851.1 ATP-binding protein Regulator
  JAV55_RS16465 (JAV55_16465) comX 3189969..3190133 (-) 165 WP_003184853.1 competence pheromone ComX -
  JAV55_RS16470 (JAV55_16470) - 3190142..3191023 (-) 882 WP_021837675.1 polyprenyl synthetase family protein -
  JAV55_RS16475 (JAV55_16475) degQ 3191212..3191352 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  JAV55_RS16480 (JAV55_16480) - 3191838..3192185 (+) 348 WP_231105863.1 SDR family oxidoreductase -
  JAV55_RS16485 (JAV55_16485) - 3192228..3193448 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  JAV55_RS16490 (JAV55_16490) - 3193627..3195096 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  JAV55_RS16495 (JAV55_16495) - 3195114..3195665 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  JAV55_RS16500 (JAV55_16500) - 3195850..3196251 (-) 402 WP_003184870.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=515558 JAV55_RS16475 WP_003184860.1 3191212..3191352(-) (degQ) [Bacillus licheniformis strain H2]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=515558 JAV55_RS16475 WP_003184860.1 3191212..3191352(-) (degQ) [Bacillus licheniformis strain H2]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P69890

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652