Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   SSUST1_RS06580 Genome accession   NC_017950
Coordinates   1328177..1328710 (-) Length   177 a.a.
NCBI ID   WP_014736108.1    Uniprot ID   -
Organism   Streptococcus suis ST1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1298394..1337056 1328177..1328710 within 0


Gene organization within MGE regions


Location: 1298394..1337056
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SSUST1_RS06385 (SSUST1_1307) - 1298394..1299104 (-) 711 WP_014736072.1 CHAP domain-containing protein -
  SSUST1_RS06390 (SSUST1_1309) - 1299234..1299437 (-) 204 WP_014736074.1 phage holin -
  SSUST1_RS06395 (SSUST1_1310) - 1299412..1299867 (-) 456 WP_014736075.1 hypothetical protein -
  SSUST1_RS06400 (SSUST1_1311) - 1299880..1300146 (-) 267 WP_014736076.1 hypothetical protein -
  SSUST1_RS06405 (SSUST1_1312) - 1300208..1302262 (-) 2055 WP_014736077.1 DUF859 family phage minor structural protein -
  SSUST1_RS10600 (SSUST1_1313) - 1302275..1306717 (-) 4443 WP_014736078.1 phage tail spike protein -
  SSUST1_RS06420 (SSUST1_1314) - 1306717..1308219 (-) 1503 WP_014736079.1 distal tail protein Dit -
  SSUST1_RS06425 (SSUST1_1315) - 1308216..1311578 (-) 3363 WP_014736080.1 hypothetical protein -
  SSUST1_RS06430 (SSUST1_1316) - 1311598..1312185 (-) 588 WP_014736081.1 Gp15 family bacteriophage protein -
  SSUST1_RS06435 - 1312185..1312553 (-) 369 WP_024405242.1 hypothetical protein -
  SSUST1_RS06440 (SSUST1_1317) - 1312576..1313034 (-) 459 WP_014736082.1 phage tail tube protein -
  SSUST1_RS06445 (SSUST1_1318) - 1313038..1313445 (-) 408 WP_014736083.1 minor capsid protein -
  SSUST1_RS06450 (SSUST1_1319) - 1313445..1313795 (-) 351 WP_014736084.1 minor capsid protein -
  SSUST1_RS06455 (SSUST1_1320) - 1313795..1314121 (-) 327 WP_014736085.1 putative minor capsid protein -
  SSUST1_RS06460 (SSUST1_1321) - 1314111..1314506 (-) 396 WP_014736086.1 hypothetical protein -
  SSUST1_RS06465 (SSUST1_1322) - 1314550..1314804 (-) 255 WP_014736087.1 hypothetical protein -
  SSUST1_RS06470 (SSUST1_1323) - 1314815..1315693 (-) 879 WP_014736088.1 hypothetical protein -
  SSUST1_RS06475 (SSUST1_1324) - 1315712..1316278 (-) 567 WP_014736089.1 phage scaffolding protein -
  SSUST1_RS06480 (SSUST1_1325) - 1316425..1317576 (-) 1152 WP_014736090.1 phage minor capsid protein -
  SSUST1_RS06485 (SSUST1_1326) - 1317579..1317827 (-) 249 WP_024405241.1 hypothetical protein -
  SSUST1_RS06490 (SSUST1_1327) - 1317814..1319403 (-) 1590 WP_014736092.1 phage portal protein -
  SSUST1_RS06495 (SSUST1_1328) - 1319415..1320740 (-) 1326 WP_014736093.1 PBSX family phage terminase large subunit -
  SSUST1_RS06500 (SSUST1_1329) - 1320730..1321221 (-) 492 WP_014736094.1 terminase small subunit -
  SSUST1_RS06505 (SSUST1_1330) - 1321413..1321796 (-) 384 WP_014736095.1 hypothetical protein -
  SSUST1_RS06510 (SSUST1_1331) - 1321793..1322464 (-) 672 WP_014736096.1 DUF4417 domain-containing protein -
  SSUST1_RS06515 (SSUST1_1332) - 1322533..1322913 (-) 381 WP_014736097.1 hypothetical protein -
  SSUST1_RS06520 (SSUST1_1333) - 1322914..1323150 (-) 237 WP_014736098.1 hypothetical protein -
  SSUST1_RS06525 - 1323143..1323328 (-) 186 WP_024405239.1 hypothetical protein -
  SSUST1_RS06530 (SSUST1_1334) - 1323315..1323731 (-) 417 WP_014736099.1 hypothetical protein -
  SSUST1_RS06535 - 1323728..1323958 (-) 231 WP_024405238.1 hypothetical protein -
  SSUST1_RS06540 (SSUST1_1335) - 1323951..1324181 (-) 231 WP_014736100.1 hypothetical protein -
  SSUST1_RS06545 (SSUST1_1336) - 1324182..1324484 (-) 303 WP_014736101.1 DUF1372 family protein -
  SSUST1_RS06550 (SSUST1_1337) - 1324485..1325336 (-) 852 WP_014736102.1 prohibitin family protein -
  SSUST1_RS11445 (SSUST1_1338) - 1325349..1325474 (-) 126 WP_268739896.1 hypothetical protein -
  SSUST1_RS06555 (SSUST1_1339) - 1325531..1325935 (-) 405 WP_014736104.1 hypothetical protein -
  SSUST1_RS06560 (SSUST1_1340) - 1325956..1326693 (-) 738 WP_014736105.1 hypothetical protein -
  SSUST1_RS06565 (SSUST1_1341) - 1326695..1327129 (-) 435 WP_014736106.1 hypothetical protein -
  SSUST1_RS06570 (SSUST1_1342) - 1327140..1327574 (-) 435 WP_014736107.1 helix-turn-helix domain-containing protein -
  SSUST1_RS11505 - 1327883..1328161 (-) 279 Protein_1255 hypothetical protein -
  SSUST1_RS06580 (SSUST1_1343) ssbA 1328177..1328710 (-) 534 WP_014736108.1 single-stranded DNA-binding protein Machinery gene
  SSUST1_RS11115 - 1328700..1328876 (-) 177 WP_153308538.1 hypothetical protein -
  SSUST1_RS06585 (SSUST1_1344) - 1328876..1329409 (-) 534 WP_014736109.1 MazG-like family protein -
  SSUST1_RS06590 (SSUST1_1345) - 1329409..1330431 (-) 1023 WP_014736110.1 DUF1351 domain-containing protein -
  SSUST1_RS06595 (SSUST1_1346) - 1330435..1331127 (-) 693 WP_014736111.1 ERF family protein -
  SSUST1_RS10980 (SSUST1_1347) - 1331131..1332093 (-) 963 WP_014736112.1 hypothetical protein -
  SSUST1_RS10620 (SSUST1_1348) - 1332440..1332598 (-) 159 WP_014736113.1 hypothetical protein -
  SSUST1_RS06605 (SSUST1_1349) - 1332721..1333038 (-) 318 WP_014736114.1 DNA-binding protein -
  SSUST1_RS06610 (SSUST1_1350) - 1333081..1333359 (-) 279 WP_014736115.1 hypothetical protein -
  SSUST1_RS06615 (SSUST1_1351) - 1333602..1334102 (-) 501 WP_014736116.1 hypothetical protein -
  SSUST1_RS06620 (SSUST1_1352) - 1334113..1334304 (-) 192 WP_014736117.1 hypothetical protein -
  SSUST1_RS06625 (SSUST1_1353) - 1334613..1334960 (+) 348 WP_014736118.1 helix-turn-helix domain-containing protein -
  SSUST1_RS06630 (SSUST1_1354) - 1334973..1335356 (+) 384 WP_014736119.1 ImmA/IrrE family metallo-endopeptidase -
  SSUST1_RS06635 (SSUST1_1355) - 1335366..1336163 (+) 798 WP_014736120.1 hypothetical protein -
  SSUST1_RS06640 (SSUST1_1356) - 1336286..1337056 (+) 771 WP_050572622.1 Arm DNA-binding domain-containing protein -

Sequence

Protein


Download         Length: 177 a.a.        Molecular weight: 19704.35 Da        Isoelectric Point: 5.7104

>NTDB_id=51481 SSUST1_RS06580 WP_014736108.1 1328177..1328710(-) (ssbA) [Streptococcus suis ST1]
MINNVVLVGRLTRDAELRYTPSNVAVATFTLAVNRSFKNEAGEREADFINCVIWRQAAENLANWAKKGSLIGITGNIQTR
HYDNQQGQRVYVTEVIASNFQLLESRNNQSGQQNQSNSFHNGNNSNSGNFQSGNNQGGYQSPFGNQSTPDFSRSNQQSFF
QGQTTNPMDISDDDLPF

Nucleotide


Download         Length: 534 bp        

>NTDB_id=51481 SSUST1_RS06580 WP_014736108.1 1328177..1328710(-) (ssbA) [Streptococcus suis ST1]
ATGATAAATAACGTTGTTTTAGTAGGGCGACTGACTAGAGATGCTGAATTAAGATATACACCATCAAATGTTGCAGTTGC
CACTTTTACCCTTGCAGTAAATCGCTCTTTCAAAAATGAGGCTGGTGAACGTGAGGCAGATTTTATCAATTGTGTAATTT
GGCGACAAGCAGCAGAAAACCTTGCTAATTGGGCTAAGAAAGGCTCATTGATTGGTATTACAGGAAATATCCAAACACGC
CACTATGACAATCAACAAGGGCAGCGCGTGTATGTGACAGAAGTTATTGCAAGTAATTTTCAATTGTTGGAAAGTCGGAA
CAATCAAAGCGGACAGCAGAACCAGAGCAACTCTTTCCATAATGGAAATAACTCAAATAGTGGTAATTTCCAAAGTGGAA
ACAACCAAGGAGGCTATCAGTCTCCATTTGGAAATCAATCCACACCAGATTTTAGCCGTAGCAACCAACAATCATTTTTC
CAAGGACAAACCACAAATCCTATGGATATTTCCGATGATGATTTACCTTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

54.945

100

0.565
  ssb Latilactobacillus sakei subsp. sakei 23K

55.367

100

0.554

Multiple sequence alignment