Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   I8N73_RS15875 Genome accession   NZ_CP065791
Coordinates   3231352..3231492 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain LBUM279     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3226352..3236492
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I8N73_RS15850 (I8N73_15850) - 3226679..3227062 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  I8N73_RS15855 (I8N73_15855) comA 3227084..3227728 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  I8N73_RS15860 (I8N73_15860) comP 3227809..3230115 (-) 2307 WP_199022126.1 sensor histidine kinase Regulator
  I8N73_RS15865 (I8N73_15865) comX 3230134..3230310 (-) 177 WP_015240484.1 competence pheromone ComX -
  I8N73_RS15870 (I8N73_15870) - 3230325..3231200 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  I8N73_RS15875 (I8N73_15875) degQ 3231352..3231492 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  I8N73_RS15880 (I8N73_15880) - 3231958..3232299 (+) 342 WP_007408677.1 hypothetical protein -
  I8N73_RS15885 (I8N73_15885) - 3232306..3233529 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  I8N73_RS15890 (I8N73_15890) - 3233659..3235125 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  I8N73_RS15895 (I8N73_15895) - 3235143..3235694 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  I8N73_RS15900 (I8N73_15900) - 3235791..3236189 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=514570 I8N73_RS15875 WP_003152043.1 3231352..3231492(-) (degQ) [Bacillus velezensis strain LBUM279]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=514570 I8N73_RS15875 WP_003152043.1 3231352..3231492(-) (degQ) [Bacillus velezensis strain LBUM279]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891