Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   I8N73_RS02105 Genome accession   NZ_CP065791
Coordinates   447023..447142 (+) Length   39 a.a.
NCBI ID   WP_064115825.1    Uniprot ID   -
Organism   Bacillus velezensis strain LBUM279     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 442023..452142
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I8N73_RS02090 (I8N73_02090) - 443635..444318 (+) 684 WP_007410267.1 response regulator transcription factor -
  I8N73_RS02095 (I8N73_02095) - 444305..445738 (+) 1434 WP_179288762.1 sensor histidine kinase -
  I8N73_RS02100 (I8N73_02100) rapC 445891..447039 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  I8N73_RS02105 (I8N73_02105) phrC 447023..447142 (+) 120 WP_064115825.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  I8N73_RS02110 (I8N73_02110) - 447291..447401 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  I8N73_RS02115 (I8N73_02115) - 447481..448845 (-) 1365 WP_199022338.1 aspartate kinase -
  I8N73_RS02120 (I8N73_02120) ceuB 449259..450212 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  I8N73_RS02125 (I8N73_02125) - 450202..451149 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  I8N73_RS02130 (I8N73_02130) - 451143..451901 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4210.94 Da        Isoelectric Point: 8.0284

>NTDB_id=514520 I8N73_RS02105 WP_064115825.1 447023..447142(+) (phrC) [Bacillus velezensis strain LBUM279]
MKLKSKWFVICLAAAAIFTVTGAGQPDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=514520 I8N73_RS02105 WP_064115825.1 447023..447142(+) (phrC) [Bacillus velezensis strain LBUM279]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGCCAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744