Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   I8N72_RS01940 Genome accession   NZ_CP065790
Coordinates   384548..384667 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain LBUM1082     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 379548..389667
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I8N72_RS01925 (I8N72_01925) - 381160..381843 (+) 684 WP_015388707.1 response regulator transcription factor -
  I8N72_RS01930 (I8N72_01930) - 381830..383263 (+) 1434 WP_161625271.1 sensor histidine kinase -
  I8N72_RS01935 (I8N72_01935) rapC 383416..384564 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  I8N72_RS01940 (I8N72_01940) phrC 384548..384667 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  I8N72_RS01945 (I8N72_01945) - 384817..384927 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  I8N72_RS01950 (I8N72_01950) - 385007..386371 (-) 1365 WP_014304341.1 aspartate kinase -
  I8N72_RS01955 (I8N72_01955) ceuB 386786..387739 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  I8N72_RS01960 (I8N72_01960) - 387729..388676 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  I8N72_RS01965 (I8N72_01965) - 388670..389428 (+) 759 WP_015388706.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=514445 I8N72_RS01940 WP_003156334.1 384548..384667(+) (phrC) [Bacillus velezensis strain LBUM1082]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=514445 I8N72_RS01940 WP_003156334.1 384548..384667(+) (phrC) [Bacillus velezensis strain LBUM1082]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718