Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   MUS_RS12900 Genome accession   NC_017912
Coordinates   2664986..2665363 (-) Length   125 a.a.
NCBI ID   WP_014418373.1    Uniprot ID   I2C7P9
Organism   Bacillus velezensis YAU B9601-Y2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2659986..2670363
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUS_RS12860 (MUS_2756) - 2660483..2661277 (+) 795 WP_014418368.1 YqhG family protein -
  MUS_RS12865 (MUS_2757) sinI 2661454..2661627 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  MUS_RS12870 (MUS_2758) sinR 2661661..2661996 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MUS_RS12875 (MUS_2759) - 2662044..2662829 (-) 786 WP_007408329.1 TasA family protein -
  MUS_RS12880 (MUS_2760) - 2662894..2663478 (-) 585 WP_014418370.1 signal peptidase I -
  MUS_RS12885 (MUS_2761) tapA 2663450..2664121 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  MUS_RS12890 (MUS_2762) - 2664380..2664709 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  MUS_RS12895 (MUS_2763) - 2664750..2664929 (-) 180 WP_003153093.1 YqzE family protein -
  MUS_RS12900 (MUS_2764) comGG 2664986..2665363 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  MUS_RS12905 (MUS_2765) comGF 2665364..2665759 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  MUS_RS12910 (MUS_2766) comGE 2665773..2666087 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  MUS_RS12915 (MUS_2767) comGD 2666071..2666508 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  MUS_RS12920 (MUS_2768) comGC 2666498..2666764 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  MUS_RS12925 (MUS_2769) comGB 2666811..2667848 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  MUS_RS12930 (MUS_2770) comGA 2667835..2668905 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  MUS_RS12935 (MUS_2771) - 2669098..2670048 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14119.10 Da        Isoelectric Point: 9.9337

>NTDB_id=51247 MUS_RS12900 WP_014418373.1 2664986..2665363(-) (comGG) [Bacillus velezensis YAU B9601-Y2]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVKVTIQAETMTGTRREATLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=51247 MUS_RS12900 WP_014418373.1 2664986..2665363(-) (comGG) [Bacillus velezensis YAU B9601-Y2]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGCCGGGAAACGGTTAAGGTTACAATTCAGGCGGAAACCATGACAGGCACGAGACGGGA
GGCTACCCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment