Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   MUS_RS12865 Genome accession   NC_017912
Coordinates   2661454..2661627 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis YAU B9601-Y2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2656454..2666627
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUS_RS12850 (MUS_2754) gcvT 2657267..2658367 (-) 1101 WP_014418366.1 glycine cleavage system aminomethyltransferase GcvT -
  MUS_RS12855 (MUS_2755) - 2658791..2660461 (+) 1671 WP_021494309.1 SNF2-related protein -
  MUS_RS12860 (MUS_2756) - 2660483..2661277 (+) 795 WP_014418368.1 YqhG family protein -
  MUS_RS12865 (MUS_2757) sinI 2661454..2661627 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  MUS_RS12870 (MUS_2758) sinR 2661661..2661996 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MUS_RS12875 (MUS_2759) - 2662044..2662829 (-) 786 WP_007408329.1 TasA family protein -
  MUS_RS12880 (MUS_2760) - 2662894..2663478 (-) 585 WP_014418370.1 signal peptidase I -
  MUS_RS12885 (MUS_2761) tapA 2663450..2664121 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  MUS_RS12890 (MUS_2762) - 2664380..2664709 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  MUS_RS12895 (MUS_2763) - 2664750..2664929 (-) 180 WP_003153093.1 YqzE family protein -
  MUS_RS12900 (MUS_2764) comGG 2664986..2665363 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  MUS_RS12905 (MUS_2765) comGF 2665364..2665759 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  MUS_RS12910 (MUS_2766) comGE 2665773..2666087 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  MUS_RS12915 (MUS_2767) comGD 2666071..2666508 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=51245 MUS_RS12865 WP_014418369.1 2661454..2661627(+) (sinI) [Bacillus velezensis YAU B9601-Y2]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=51245 MUS_RS12865 WP_014418369.1 2661454..2661627(+) (sinI) [Bacillus velezensis YAU B9601-Y2]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment