Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | MUS_RS12865 | Genome accession | NC_017912 |
| Coordinates | 2661454..2661627 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis YAU B9601-Y2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2656454..2666627
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUS_RS12850 (MUS_2754) | gcvT | 2657267..2658367 (-) | 1101 | WP_014418366.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MUS_RS12855 (MUS_2755) | - | 2658791..2660461 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| MUS_RS12860 (MUS_2756) | - | 2660483..2661277 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| MUS_RS12865 (MUS_2757) | sinI | 2661454..2661627 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| MUS_RS12870 (MUS_2758) | sinR | 2661661..2661996 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| MUS_RS12875 (MUS_2759) | - | 2662044..2662829 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| MUS_RS12880 (MUS_2760) | - | 2662894..2663478 (-) | 585 | WP_014418370.1 | signal peptidase I | - |
| MUS_RS12885 (MUS_2761) | tapA | 2663450..2664121 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| MUS_RS12890 (MUS_2762) | - | 2664380..2664709 (+) | 330 | WP_014418372.1 | DUF3889 domain-containing protein | - |
| MUS_RS12895 (MUS_2763) | - | 2664750..2664929 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| MUS_RS12900 (MUS_2764) | comGG | 2664986..2665363 (-) | 378 | WP_014418373.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| MUS_RS12905 (MUS_2765) | comGF | 2665364..2665759 (-) | 396 | WP_014721501.1 | competence type IV pilus minor pilin ComGF | - |
| MUS_RS12910 (MUS_2766) | comGE | 2665773..2666087 (-) | 315 | WP_032863566.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| MUS_RS12915 (MUS_2767) | comGD | 2666071..2666508 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=51245 MUS_RS12865 WP_014418369.1 2661454..2661627(+) (sinI) [Bacillus velezensis YAU B9601-Y2]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=51245 MUS_RS12865 WP_014418369.1 2661454..2661627(+) (sinI) [Bacillus velezensis YAU B9601-Y2]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |