Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   I5367_RS11610 Genome accession   NZ_CP065539
Coordinates   2422602..2422775 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain DGL1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2417602..2427775
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I5367_RS11595 (I5367_11595) gcvT 2418415..2419515 (-) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -
  I5367_RS11600 (I5367_11600) - 2419939..2421609 (+) 1671 WP_012117975.1 DEAD/DEAH box helicase -
  I5367_RS11605 (I5367_11605) - 2421631..2422425 (+) 795 WP_012117976.1 YqhG family protein -
  I5367_RS11610 (I5367_11610) sinI 2422602..2422775 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  I5367_RS11615 (I5367_11615) sinR 2422809..2423144 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  I5367_RS11620 (I5367_11620) tasA 2423192..2423977 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  I5367_RS11625 (I5367_11625) sipW 2424042..2424626 (-) 585 WP_012117977.1 signal peptidase I SipW -
  I5367_RS11630 (I5367_11630) tapA 2424598..2425269 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  I5367_RS11635 (I5367_11635) - 2425528..2425857 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  I5367_RS11640 (I5367_11640) - 2425897..2426076 (-) 180 WP_003153093.1 YqzE family protein -
  I5367_RS11645 (I5367_11645) comGG 2426133..2426510 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  I5367_RS11650 (I5367_11650) comGF 2426511..2427011 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  I5367_RS11655 (I5367_11655) comGE 2426920..2427234 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  I5367_RS11660 (I5367_11660) comGD 2427218..2427655 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=511765 I5367_RS11610 WP_003153105.1 2422602..2422775(+) (sinI) [Bacillus amyloliquefaciens strain DGL1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=511765 I5367_RS11610 WP_003153105.1 2422602..2422775(+) (sinI) [Bacillus amyloliquefaciens strain DGL1]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702