Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   I3J23_RS02285 Genome accession   NZ_CP065159
Coordinates   438491..438805 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain GXU-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 433491..443805
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I3J23_RS02240 (I3J23_02240) sinI 434174..434347 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  I3J23_RS02245 (I3J23_02245) sinR 434381..434716 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  I3J23_RS02250 (I3J23_02250) - 434764..435549 (-) 786 WP_003153102.1 TasA family protein -
  I3J23_RS02255 (I3J23_02255) - 435613..436197 (-) 585 WP_046559873.1 signal peptidase I -
  I3J23_RS02260 (I3J23_02260) tapA 436169..436840 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  I3J23_RS02265 (I3J23_02265) - 437099..437428 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  I3J23_RS02270 (I3J23_02270) - 437468..437647 (-) 180 WP_003153093.1 YqzE family protein -
  I3J23_RS02275 (I3J23_02275) comGG 437704..438081 (-) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  I3J23_RS02280 (I3J23_02280) comGF 438082..438582 (-) 501 WP_224979425.1 competence type IV pilus minor pilin ComGF -
  I3J23_RS02285 (I3J23_02285) comGE 438491..438805 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  I3J23_RS02290 (I3J23_02290) comGD 438789..439226 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  I3J23_RS02295 (I3J23_02295) comGC 439216..439524 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  I3J23_RS02300 (I3J23_02300) comGB 439529..440566 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  I3J23_RS02305 (I3J23_02305) comGA 440553..441623 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  I3J23_RS02310 (I3J23_02310) - 441815..442765 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=507511 I3J23_RS02285 WP_015388003.1 438491..438805(-) (comGE) [Bacillus amyloliquefaciens strain GXU-1]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=507511 I3J23_RS02285 WP_015388003.1 438491..438805(-) (comGE) [Bacillus amyloliquefaciens strain GXU-1]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481