Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   I3J23_RS02240 Genome accession   NZ_CP065159
Coordinates   434174..434347 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain GXU-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 429174..439347
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I3J23_RS02225 (I3J23_02225) gcvT 429991..431091 (-) 1101 WP_207579557.1 glycine cleavage system aminomethyltransferase GcvT -
  I3J23_RS02230 (I3J23_02230) - 431515..433185 (+) 1671 WP_003153107.1 SNF2-related protein -
  I3J23_RS02235 (I3J23_02235) - 433203..433997 (+) 795 WP_003153106.1 YqhG family protein -
  I3J23_RS02240 (I3J23_02240) sinI 434174..434347 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  I3J23_RS02245 (I3J23_02245) sinR 434381..434716 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  I3J23_RS02250 (I3J23_02250) - 434764..435549 (-) 786 WP_003153102.1 TasA family protein -
  I3J23_RS02255 (I3J23_02255) - 435613..436197 (-) 585 WP_046559873.1 signal peptidase I -
  I3J23_RS02260 (I3J23_02260) tapA 436169..436840 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  I3J23_RS02265 (I3J23_02265) - 437099..437428 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  I3J23_RS02270 (I3J23_02270) - 437468..437647 (-) 180 WP_003153093.1 YqzE family protein -
  I3J23_RS02275 (I3J23_02275) comGG 437704..438081 (-) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  I3J23_RS02280 (I3J23_02280) comGF 438082..438582 (-) 501 WP_224979425.1 competence type IV pilus minor pilin ComGF -
  I3J23_RS02285 (I3J23_02285) comGE 438491..438805 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  I3J23_RS02290 (I3J23_02290) comGD 438789..439226 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=507508 I3J23_RS02240 WP_003153105.1 434174..434347(+) (sinI) [Bacillus amyloliquefaciens strain GXU-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=507508 I3J23_RS02240 WP_003153105.1 434174..434347(+) (sinI) [Bacillus amyloliquefaciens strain GXU-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702