Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   IRJ20_RS01935 Genome accession   NZ_CP065137
Coordinates   378909..379286 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus sp. A1(2020)     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 373909..384286
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ20_RS01895 - 374407..375201 (+) 795 WP_007408330.1 YqhG family protein -
  IRJ20_RS01900 sinI 375378..375551 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  IRJ20_RS01905 sinR 375585..375920 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IRJ20_RS01910 - 375968..376753 (-) 786 WP_007408329.1 TasA family protein -
  IRJ20_RS01915 - 376818..377402 (-) 585 WP_015240205.1 signal peptidase I -
  IRJ20_RS01920 tapA 377374..378045 (-) 672 WP_242750417.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ20_RS01925 - 378304..378633 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  IRJ20_RS01930 - 378673..378852 (-) 180 WP_003153093.1 YqzE family protein -
  IRJ20_RS01935 comGG 378909..379286 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  IRJ20_RS01940 comGF 379287..379787 (-) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  IRJ20_RS01945 comGE 379696..380010 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  IRJ20_RS01950 comGD 379994..380431 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  IRJ20_RS01955 comGC 380421..380687 (-) 267 WP_050515801.1 competence type IV pilus major pilin ComGC Machinery gene
  IRJ20_RS01960 comGB 380734..381771 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  IRJ20_RS01965 comGA 381758..382828 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  IRJ20_RS01970 - 383021..383971 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=507194 IRJ20_RS01935 WP_015417814.1 378909..379286(-) (comGG) [Bacillus sp. A1(2020)]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=507194 IRJ20_RS01935 WP_015417814.1 378909..379286(-) (comGG) [Bacillus sp. A1(2020)]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACTTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504