Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IRJ20_RS01900 Genome accession   NZ_CP065137
Coordinates   375378..375551 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus sp. A1(2020)     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 370378..380551
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ20_RS01885 gcvT 371191..372291 (-) 1101 WP_015240202.1 glycine cleavage system aminomethyltransferase GcvT -
  IRJ20_RS01890 - 372715..374385 (+) 1671 WP_031378948.1 SNF2-related protein -
  IRJ20_RS01895 - 374407..375201 (+) 795 WP_007408330.1 YqhG family protein -
  IRJ20_RS01900 sinI 375378..375551 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  IRJ20_RS01905 sinR 375585..375920 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IRJ20_RS01910 - 375968..376753 (-) 786 WP_007408329.1 TasA family protein -
  IRJ20_RS01915 - 376818..377402 (-) 585 WP_015240205.1 signal peptidase I -
  IRJ20_RS01920 tapA 377374..378045 (-) 672 WP_242750417.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ20_RS01925 - 378304..378633 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  IRJ20_RS01930 - 378673..378852 (-) 180 WP_003153093.1 YqzE family protein -
  IRJ20_RS01935 comGG 378909..379286 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  IRJ20_RS01940 comGF 379287..379787 (-) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  IRJ20_RS01945 comGE 379696..380010 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  IRJ20_RS01950 comGD 379994..380431 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=507192 IRJ20_RS01900 WP_003153105.1 375378..375551(+) (sinI) [Bacillus sp. A1(2020)]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=507192 IRJ20_RS01900 WP_003153105.1 375378..375551(+) (sinI) [Bacillus sp. A1(2020)]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702