Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MY9_RS15905 Genome accession   NC_017743
Coordinates   3121817..3121957 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. JS     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3116817..3126957
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MY9_RS15880 (MY9_3179) - 3117159..3117539 (-) 381 WP_014665189.1 hotdog fold thioesterase -
  MY9_RS15885 (MY9_3180) comA 3117558..3118202 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MY9_RS15890 (MY9_3181) comP 3118283..3120583 (-) 2301 WP_014665190.1 histidine kinase Regulator
  MY9_RS15895 (MY9_3182) comX 3120595..3120759 (-) 165 WP_014665191.1 competence pheromone ComX -
  MY9_RS15900 (MY9_3183) - 3120772..3121632 (-) 861 WP_014665192.1 polyprenyl synthetase family protein -
  MY9_RS15905 (MY9_3184) degQ 3121817..3121957 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MY9_RS21655 - 3122179..3122304 (+) 126 WP_128422565.1 hypothetical protein -
  MY9_RS15910 (MY9_3185) - 3122419..3122787 (+) 369 WP_014665193.1 hypothetical protein -
  MY9_RS15915 (MY9_3186) pdeH 3122763..3123992 (-) 1230 WP_014665194.1 cyclic di-GMP phosphodiesterase -
  MY9_RS15920 (MY9_3187) - 3124128..3125600 (-) 1473 WP_014665195.1 nicotinate phosphoribosyltransferase -
  MY9_RS15925 (MY9_3188) - 3125616..3126167 (-) 552 WP_014665196.1 isochorismatase family cysteine hydrolase -
  MY9_RS15930 (MY9_3189) - 3126264..3126662 (-) 399 WP_040081965.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=50635 MY9_RS15905 WP_003220708.1 3121817..3121957(-) (degQ) [Bacillus sp. JS]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=50635 MY9_RS15905 WP_003220708.1 3121817..3121957(-) (degQ) [Bacillus sp. JS]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATCGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment