Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPSH169_RS00195 Genome accession   NC_017740
Coordinates   33609..33722 (+) Length   37 a.a.
NCBI ID   WP_001217864.1    Uniprot ID   A0A0E0W910
Organism   Helicobacter pylori Shi169     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 28609..38722
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPSH169_RS00170 (HPSH169_00155) - 28648..30870 (+) 2223 WP_001051543.1 AAA family ATPase -
  HPSH169_RS00175 (HPSH169_00160) panD 30860..31210 (+) 351 WP_000142289.1 aspartate 1-decarboxylase -
  HPSH169_RS00180 (HPSH169_00165) - 31221..31523 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HPSH169_RS00185 (HPSH169_00170) - 31523..32530 (+) 1008 WP_000468454.1 PDZ domain-containing protein -
  HPSH169_RS00190 (HPSH169_00175) comB6 32538..33593 (+) 1056 WP_000786690.1 P-type conjugative transfer protein TrbL Machinery gene
  HPSH169_RS00195 (HPSH169_00180) comB7 33609..33722 (+) 114 WP_001217864.1 hypothetical protein Machinery gene
  HPSH169_RS00200 (HPSH169_00185) comB8 33719..34462 (+) 744 WP_000660502.1 type IV secretion system protein Machinery gene
  HPSH169_RS00205 (HPSH169_00190) comB9 34462..35418 (+) 957 WP_014662053.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPSH169_RS00210 (HPSH169_00195) comB10 35411..36547 (+) 1137 WP_001045877.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPSH169_RS00215 (HPSH169_00200) - 36617..38029 (+) 1413 WP_000694835.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=50509 HPSH169_RS00195 WP_001217864.1 33609..33722(+) (comB7) [Helicobacter pylori Shi169]
MRIFFVIIGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=50509 HPSH169_RS00195 WP_001217864.1 33609..33722(+) (comB7) [Helicobacter pylori Shi169]
ATGAGAATTTTTTTTGTTATTATAGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0E0W910

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892


Multiple sequence alignment