Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB3   Type   Machinery gene
Locus tag   HCW_RS08130 Genome accession   NC_017737
Coordinates   1768635..1768898 (+) Length   87 a.a.
NCBI ID   WP_014661735.1    Uniprot ID   -
Organism   Helicobacter cetorum MIT 00-7128     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1763744..1821806 1768635..1768898 within 0


Gene organization within MGE regions


Location: 1763744..1821806
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCW_RS09155 (HCW_08030) - 1764852..1766480 (+) 1629 WP_014661730.1 McrB family protein -
  HCW_RS08105 (HCW_08035) - 1766464..1766793 (+) 330 WP_014661731.1 hypothetical protein -
  HCW_RS08110 (HCW_08040) - 1766841..1767629 (+) 789 WP_014661732.1 hypothetical protein -
  HCW_RS08120 (HCW_08045) - 1767859..1768338 (+) 480 WP_014661733.1 hypothetical protein -
  HCW_RS08125 (HCW_08050) comB2 1768335..1768625 (+) 291 WP_014661734.1 TrbC/VirB2 family protein Machinery gene
  HCW_RS08130 (HCW_08055) comB3 1768635..1768898 (+) 264 WP_014661735.1 hypothetical protein Machinery gene
  HCW_RS08135 (HCW_08060) - 1768909..1769145 (+) 237 WP_014661736.1 hypothetical protein -
  HCW_RS08140 (HCW_08065) - 1769145..1771688 (+) 2544 WP_014661737.1 VirB4 family type IV secretion/conjugal transfer ATPase -
  HCW_RS10050 (HCW_08070) - 1771689..1771829 (+) 141 WP_014661738.1 hypothetical protein -
  HCW_RS08150 (HCW_08075) - 1771822..1772964 (+) 1143 WP_014661739.1 VirB8/TrbF family protein -
  HCW_RS08155 (HCW_08080) - 1772961..1774634 (+) 1674 WP_014661740.1 TrbG/VirB9 family P-type conjugative transfer protein -
  HCW_RS08160 (HCW_08085) comB10 1774631..1775833 (+) 1203 WP_014661741.1 DNA type IV secretion system protein ComB10 Machinery gene
  HCW_RS08165 (HCW_08090) - 1775817..1778072 (+) 2256 WP_014661742.1 hypothetical protein -
  HCW_RS08170 (HCW_08095) - 1778086..1779036 (+) 951 WP_014661743.1 membrane protein -
  HCW_RS08175 (HCW_08100) - 1779054..1779329 (+) 276 WP_014661744.1 hypothetical protein -
  HCW_RS08180 (HCW_08105) - 1779334..1780281 (+) 948 WP_014661745.1 ATPase, T2SS/T4P/T4SS family -
  HCW_RS08185 (HCW_08110) - 1780278..1780796 (+) 519 WP_014661746.1 hypothetical protein -
  HCW_RS08190 (HCW_08115) - 1780793..1783027 (+) 2235 WP_014661747.1 type IV secretory system conjugative DNA transfer family protein -
  HCW_RS08195 (HCW_08120) - 1783155..1795178 (+) 12024 WP_419470993.1 SNF2-related protein -
  HCW_RS08200 (HCW_08125) - 1795298..1795816 (+) 519 WP_014661011.1 hypothetical protein -
  HCW_RS08205 (HCW_08130) - 1795826..1796272 (+) 447 WP_014661010.1 hypothetical protein -
  HCW_RS08210 (HCW_08135) - 1796292..1796573 (+) 282 WP_014661009.1 hypothetical protein -
  HCW_RS09495 - 1796570..1796746 (+) 177 WP_155802237.1 hypothetical protein -
  HCW_RS08215 (HCW_08140) - 1796759..1796965 (+) 207 WP_014661008.1 hypothetical protein -
  HCW_RS08220 (HCW_08145) - 1796965..1797720 (+) 756 WP_014661749.1 hypothetical protein -
  HCW_RS08225 (HCW_08150) - 1797724..1798077 (+) 354 WP_014661750.1 hypothetical protein -
  HCW_RS09500 (HCW_08155) - 1798074..1798226 (+) 153 WP_014661751.1 hypothetical protein -
  HCW_RS08230 (HCW_08160) - 1798226..1798750 (+) 525 WP_014661752.1 hypothetical protein -
  HCW_RS08235 (HCW_08165) - 1798762..1800825 (+) 2064 WP_014661753.1 type IA DNA topoisomerase -
  HCW_RS08240 (HCW_08170) - 1800880..1801347 (+) 468 WP_014661754.1 hypothetical protein -
  HCW_RS08245 (HCW_08175) - 1801317..1802111 (+) 795 WP_014661755.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  HCW_RS08250 (HCW_08180) - 1802174..1802809 (-) 636 WP_043902694.1 hypothetical protein -
  HCW_RS08255 (HCW_08185) - 1802787..1803163 (-) 377 Protein_1629 hypothetical protein -
  HCW_RS08260 (HCW_08190) - 1803210..1803878 (-) 669 WP_014661758.1 ParA family protein -
  HCW_RS09505 - 1804186..1804359 (-) 174 WP_155802267.1 hypothetical protein -
  HCW_RS08265 (HCW_08195) - 1804365..1804691 (-) 327 WP_014661759.1 hypothetical protein -
  HCW_RS08270 (HCW_08200) - 1804701..1805078 (-) 378 WP_014661760.1 hypothetical protein -
  HCW_RS09610 (HCW_08205) - 1805643..1805807 (+) 165 WP_014661761.1 hypothetical protein -
  HCW_RS08275 (HCW_08210) - 1805808..1806863 (+) 1056 WP_014661762.1 ArdC family protein -
  HCW_RS08280 (HCW_08215) - 1806863..1809187 (+) 2325 WP_014661763.1 hypothetical protein -
  HCW_RS08285 (HCW_08220) - 1809197..1810630 (+) 1434 WP_014661764.1 hypothetical protein -
  HCW_RS08290 (HCW_08225) - 1810627..1811889 (+) 1263 WP_014661765.1 type IV secretion system protein -
  HCW_RS08295 (HCW_08230) - 1811886..1813154 (+) 1269 WP_014661766.1 hypothetical protein -
  HCW_RS08300 (HCW_08235) - 1813175..1813903 (-) 729 WP_014661767.1 hypothetical protein -
  HCW_RS08305 (HCW_08240) - 1814121..1814798 (+) 678 WP_014661768.1 CAAX amino protease -
  HCW_RS08310 (HCW_08245) - 1815094..1815360 (-) 267 WP_014661769.1 hypothetical protein -
  HCW_RS08315 (HCW_08250) ctkA 1815639..1816619 (+) 981 WP_014661770.1 serine/threonine-protein kinase CtkA -
  HCW_RS08320 (HCW_08255) - 1816917..1817984 (-) 1068 WP_014661771.1 tyrosine-type recombinase/integrase -
  HCW_RS08325 (HCW_08260) - 1818828..1820855 (-) 2028 WP_014661772.1 relaxase/mobilization nuclease domain-containing protein -

Sequence


Protein


Download         Length: 87 a.a.        Molecular weight: 9996.86 Da        Isoelectric Point: 5.7206

>NTDB_id=50479 HCW_RS08130 WP_014661735.1 1768635..1768898(+) (comB3) [Helicobacter cetorum MIT 00-7128]
MQLVGISVSNLKEISSKEKFLWLNAKSFLLAGFVPFVMMPWFDLLNSFMLYACFLLIFSIAEFFDEDISDILIAHSKIKT
KANSFYA

Nucleotide


Download         Length: 264 bp        

>NTDB_id=50479 HCW_RS08130 WP_014661735.1 1768635..1768898(+) (comB3) [Helicobacter cetorum MIT 00-7128]
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGTTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
TTTTTTACTCGCTGGATTTGTGCCATTTGTAATGATGCCTTGGTTTGACTTGTTGAACTCTTTTATGCTGTATGCGTGCT
TTCTCTTAATTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGATATTTTAATCGCTCATTCCAAGATTAAAACC
AAAGCCAATTCATTTTACGCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB3 Helicobacter pylori 26695

59.77

100

0.598


Multiple sequence alignment