Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   HWI52_RS08890 Genome accession   NZ_CP064498
Coordinates   1882772..1883347 (-) Length   191 a.a.
NCBI ID   WP_001829272.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain UMCG379     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1837322..1882371 1882772..1883347 flank 401


Gene organization within MGE regions


Location: 1837322..1883347
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWI52_RS08530 (HWI52_08505) - 1837322..1837663 (-) 342 WP_002456621.1 fatty acid desaturase -
  HWI52_RS08535 (HWI52_08510) - 1837876..1838112 (-) 237 WP_001829451.1 hypothetical protein -
  HWI52_RS08540 mobV 1838314..1838874 (-) 561 Protein_1648 MobV family relaxase -
  HWI52_RS08545 (HWI52_08525) - 1839871..1840824 (-) 954 WP_316445855.1 hypothetical protein -
  HWI52_RS08550 (HWI52_08530) - 1841099..1842481 (-) 1383 WP_407568401.1 N-acetylmuramoyl-L-alanine amidase -
  HWI52_RS08555 (HWI52_08535) - 1842481..1842747 (-) 267 WP_064587793.1 phage holin -
  HWI52_RS08560 (HWI52_08540) - 1842802..1843329 (-) 528 WP_407568402.1 hypothetical protein -
  HWI52_RS08565 (HWI52_08545) - 1843329..1843838 (-) 510 WP_049368599.1 hypothetical protein -
  HWI52_RS08570 (HWI52_08550) - 1843894..1845795 (-) 1902 WP_407568403.1 glucosaminidase domain-containing protein -
  HWI52_RS08575 (HWI52_08555) - 1845934..1846233 (-) 300 WP_001830303.1 DUF2951 family protein -
  HWI52_RS08580 (HWI52_08560) - 1846270..1846410 (-) 141 WP_001830255.1 XkdX family protein -
  HWI52_RS08585 (HWI52_08565) - 1846412..1846750 (-) 339 WP_001830258.1 hypothetical protein -
  HWI52_RS08590 (HWI52_08570) - 1846755..1848287 (-) 1533 WP_407568404.1 BppU family phage baseplate upper protein -
  HWI52_RS08595 (HWI52_08575) - 1848287..1850953 (-) 2667 WP_002470848.1 peptidase G2 autoproteolytic cleavage domain-containing protein -
  HWI52_RS08600 (HWI52_08580) - 1850968..1852824 (-) 1857 WP_407568405.1 SGNH/GDSL hydrolase family protein -
  HWI52_RS08605 (HWI52_08585) - 1852838..1853776 (-) 939 WP_407568406.1 phage tail protein -
  HWI52_RS08610 (HWI52_08590) - 1853792..1856896 (-) 3105 WP_407568407.1 terminase -
  HWI52_RS08615 (HWI52_08595) - 1856899..1857201 (-) 303 WP_001830305.1 hypothetical protein -
  HWI52_RS08620 (HWI52_08600) - 1857264..1857758 (-) 495 WP_015984395.1 tail assembly chaperone -
  HWI52_RS08625 (HWI52_08605) - 1857820..1858359 (-) 540 WP_002439225.1 tail protein -
  HWI52_RS08630 (HWI52_08610) - 1858346..1858783 (-) 438 WP_064581954.1 DUF3168 domain-containing protein -
  HWI52_RS08635 (HWI52_08615) - 1858796..1859209 (-) 414 WP_281136807.1 HK97-gp10 family putative phage morphogenesis protein -
  HWI52_RS08640 (HWI52_08620) - 1859202..1859531 (-) 330 WP_407568408.1 phage head closure protein -
  HWI52_RS08645 (HWI52_08625) - 1859524..1859838 (-) 315 WP_001830262.1 phage head-tail connector protein -
  HWI52_RS08650 (HWI52_08630) - 1859838..1860128 (-) 291 WP_203068437.1 Rho termination factor N-terminal domain-containing protein -
  HWI52_RS08655 (HWI52_08635) - 1860145..1860975 (-) 831 WP_001830264.1 N4-gp56 family major capsid protein -
  HWI52_RS08660 (HWI52_08640) - 1860993..1861586 (-) 594 WP_407568409.1 phage scaffolding protein -
  HWI52_RS08665 (HWI52_08645) - 1861692..1861898 (-) 207 WP_407568410.1 hypothetical protein -
  HWI52_RS08670 (HWI52_08650) - 1861901..1862854 (-) 954 WP_407568411.1 phage head morphogenesis protein -
  HWI52_RS08675 (HWI52_08655) - 1862811..1864247 (-) 1437 WP_002470865.1 phage portal protein -
  HWI52_RS08680 (HWI52_08660) - 1864253..1865515 (-) 1263 WP_407568412.1 PBSX family phage terminase large subunit -
  HWI52_RS08685 (HWI52_08665) - 1865502..1865882 (-) 381 WP_001830293.1 phBC6A51 family helix-turn-helix protein -
  HWI52_RS08690 (HWI52_08670) - 1866331..1866747 (-) 417 WP_237615257.1 transcriptional regulator -
  HWI52_RS08695 (HWI52_08675) - 1866765..1866983 (-) 219 WP_064587819.1 hypothetical protein -
  HWI52_RS08700 (HWI52_08680) - 1866987..1867127 (-) 141 WP_002470855.1 hypothetical protein -
  HWI52_RS08705 (HWI52_08685) - 1867115..1867513 (-) 399 WP_407568413.1 hypothetical protein -
  HWI52_RS08710 (HWI52_08690) rinB 1867515..1867685 (-) 171 WP_064634334.1 transcriptional activator RinB -
  HWI52_RS08715 (HWI52_08695) - 1867678..1867830 (-) 153 WP_154812791.1 DUF1381 domain-containing protein -
  HWI52_RS08720 (HWI52_08700) - 1867827..1868231 (-) 405 WP_064634332.1 hypothetical protein -
  HWI52_RS08725 (HWI52_08705) - 1868281..1868604 (-) 324 WP_002470840.1 MazG-like family protein -
  HWI52_RS08730 (HWI52_08710) - 1868597..1868776 (-) 180 WP_002504360.1 DUF1024 family protein -
  HWI52_RS08735 (HWI52_08715) - 1868766..1869014 (-) 249 WP_001830273.1 hypothetical protein -
  HWI52_RS08740 (HWI52_08720) - 1869004..1869330 (-) 327 WP_001830268.1 hypothetical protein -
  HWI52_RS08745 - 1869314..1869514 (-) 201 WP_032605777.1 hypothetical protein -
  HWI52_RS08750 (HWI52_08725) - 1869501..1870115 (-) 615 WP_049371707.1 HNH endonuclease signature motif containing protein -
  HWI52_RS08755 (HWI52_08730) - 1870121..1870351 (-) 231 WP_049371709.1 hypothetical protein -
  HWI52_RS08760 (HWI52_08735) - 1870356..1870799 (-) 444 WP_002469452.1 DUF3310 domain-containing protein -
  HWI52_RS08765 (HWI52_08740) - 1870796..1871155 (-) 360 WP_061827613.1 SA1788 family PVL leukocidin-associated protein -
  HWI52_RS08770 (HWI52_08745) - 1871156..1871347 (-) 192 WP_002456379.1 hypothetical protein -
  HWI52_RS08775 (HWI52_08750) - 1871348..1871755 (-) 408 WP_002439172.1 RusA family crossover junction endodeoxyribonuclease -
  HWI52_RS08780 (HWI52_08755) - 1871764..1872009 (-) 246 WP_002456877.1 hypothetical protein -
  HWI52_RS08785 (HWI52_08760) - 1871987..1872208 (-) 222 WP_070858718.1 hypothetical protein -
  HWI52_RS08790 (HWI52_08765) - 1872205..1873452 (-) 1248 WP_002504983.1 DnaB-like helicase C-terminal domain-containing protein -
  HWI52_RS08795 (HWI52_08770) - 1873442..1873795 (-) 354 WP_002439168.1 hypothetical protein -
  HWI52_RS08800 (HWI52_08775) - 1873801..1874529 (-) 729 WP_061827641.1 DnaD domain protein -
  HWI52_RS08805 (HWI52_08780) - 1874535..1874765 (-) 231 WP_002469460.1 helix-turn-helix domain-containing protein -
  HWI52_RS08810 (HWI52_08785) - 1874743..1875429 (-) 687 WP_237627176.1 putative HNHc nuclease -
  HWI52_RS08815 (HWI52_08790) - 1875441..1875995 (-) 555 WP_203068406.1 single-stranded DNA-binding protein -
  HWI52_RS08820 (HWI52_08795) - 1876024..1876800 (-) 777 WP_103433708.1 ATP-binding protein -
  HWI52_RS08825 (HWI52_08800) - 1876801..1877286 (-) 486 WP_407568414.1 siphovirus Gp157 family protein -
  HWI52_RS08830 (HWI52_08805) - 1877279..1877530 (-) 252 WP_237627178.1 hypothetical protein -
  HWI52_RS08835 (HWI52_08810) - 1877592..1877768 (-) 177 WP_237627179.1 hypothetical protein -
  HWI52_RS08840 (HWI52_08815) - 1877834..1877983 (-) 150 WP_192832187.1 hypothetical protein -
  HWI52_RS08845 (HWI52_08820) - 1877999..1878208 (-) 210 WP_049367120.1 hypothetical protein -
  HWI52_RS08850 (HWI52_08825) - 1878221..1878934 (-) 714 WP_049391243.1 BRO family protein -
  HWI52_RS08855 (HWI52_08830) - 1878950..1879210 (-) 261 WP_049391242.1 helix-turn-helix transcriptional regulator -
  HWI52_RS08860 (HWI52_08835) - 1879403..1880041 (+) 639 WP_049391241.1 XRE family transcriptional regulator -
  HWI52_RS08865 (HWI52_08840) - 1880093..1880653 (+) 561 Protein_1713 DUF5067 domain-containing protein -
  HWI52_RS08870 (HWI52_08845) - 1880680..1881261 (+) 582 WP_049391239.1 hypothetical protein -
  HWI52_RS08875 (HWI52_08850) - 1881322..1882371 (+) 1050 WP_049391238.1 site-specific integrase -
  HWI52_RS08890 (HWI52_08865) comK/comK1 1882772..1883347 (-) 576 WP_001829272.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 191 a.a.        Molecular weight: 22782.87 Da        Isoelectric Point: 9.2887

>NTDB_id=502431 HWI52_RS08890 WP_001829272.1 1882772..1883347(-) (comK/comK1) [Staphylococcus epidermidis strain UMCG379]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN

Nucleotide


Download         Length: 576 bp        

>NTDB_id=502431 HWI52_RS08890 WP_001829272.1 1882772..1883347(-) (comK/comK1) [Staphylococcus epidermidis strain UMCG379]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(7-158)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.757

96.859

0.743
  comK/comK1 Staphylococcus aureus N315

76.757

96.859

0.743