Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   HWI61_RS03380 Genome accession   NZ_CP064467
Coordinates   688792..689367 (+) Length   191 a.a.
NCBI ID   WP_001829272.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain UMCG389     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 689768..732346 688792..689367 flank 401


Gene organization within MGE regions


Location: 688792..732346
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWI61_RS03380 (HWI61_03340) comK/comK1 688792..689367 (+) 576 WP_001829272.1 competence protein ComK Regulator
  HWI61_RS03395 (HWI61_03355) - 689768..690817 (-) 1050 WP_002504795.1 site-specific integrase -
  HWI61_RS03400 (HWI61_03360) - 690928..691125 (+) 198 WP_002497576.1 hypothetical protein -
  HWI61_RS03405 (HWI61_03365) - 691122..691529 (-) 408 WP_002497577.1 TIR domain-containing protein -
  HWI61_RS03410 (HWI61_03370) - 691523..691960 (-) 438 WP_002497578.1 DUF4231 domain-containing protein -
  HWI61_RS03415 (HWI61_03375) - 692072..692740 (-) 669 WP_002504794.1 hypothetical protein -
  HWI61_RS03420 (HWI61_03380) - 692758..693216 (-) 459 WP_002504200.1 ImmA/IrrE family metallo-endopeptidase -
  HWI61_RS03425 (HWI61_03385) - 693238..693552 (-) 315 WP_002504199.1 helix-turn-helix transcriptional regulator -
  HWI61_RS03430 (HWI61_03390) - 693705..693917 (+) 213 WP_002456362.1 helix-turn-helix transcriptional regulator -
  HWI61_RS03435 (HWI61_03395) - 693961..694101 (+) 141 WP_002485815.1 hypothetical protein -
  HWI61_RS03440 (HWI61_03400) - 694094..694318 (-) 225 WP_002504198.1 hypothetical protein -
  HWI61_RS03445 (HWI61_03405) - 694368..695108 (+) 741 WP_002504197.1 phage repressor protein -
  HWI61_RS03450 (HWI61_03410) - 695121..695330 (+) 210 WP_001830281.1 hypothetical protein -
  HWI61_RS03455 (HWI61_03415) - 695344..695490 (+) 147 WP_002504793.1 hypothetical protein -
  HWI61_RS03460 (HWI61_03420) - 695477..695755 (-) 279 WP_002484728.1 hypothetical protein -
  HWI61_RS03465 (HWI61_03425) - 695850..696026 (+) 177 WP_002484719.1 hypothetical protein -
  HWI61_RS03470 (HWI61_03430) - 696088..696339 (+) 252 WP_002484751.1 hypothetical protein -
  HWI61_RS03475 (HWI61_03435) - 696332..696817 (+) 486 WP_407568374.1 siphovirus Gp157 family protein -
  HWI61_RS03480 (HWI61_03440) - 696818..697444 (+) 627 WP_002469464.1 DUF1071 domain-containing protein -
  HWI61_RS03485 (HWI61_03445) - 697437..697853 (+) 417 WP_002484754.1 single-stranded DNA-binding protein -
  HWI61_RS03490 (HWI61_03450) - 697867..698556 (+) 690 WP_002504792.1 putative HNHc nuclease -
  HWI61_RS03495 (HWI61_03455) - 698534..698764 (+) 231 WP_002504791.1 helix-turn-helix domain-containing protein -
  HWI61_RS03500 (HWI61_03460) - 698770..698985 (+) 216 WP_002504790.1 helix-turn-helix domain-containing protein -
  HWI61_RS03505 (HWI61_03465) - 698972..699700 (+) 729 WP_002504789.1 DnaD domain protein -
  HWI61_RS03510 (HWI61_03470) - 699706..700059 (+) 354 WP_002504788.1 hypothetical protein -
  HWI61_RS03515 (HWI61_03475) - 700049..701296 (+) 1248 WP_002504787.1 DnaB-like helicase C-terminal domain-containing protein -
  HWI61_RS03520 (HWI61_03480) - 701293..701523 (+) 231 WP_002504786.1 hypothetical protein -
  HWI61_RS03525 (HWI61_03485) - 701492..701716 (+) 225 WP_002456377.1 DUF3269 family protein -
  HWI61_RS03530 (HWI61_03490) - 701727..702143 (+) 417 WP_002504785.1 DUF1064 domain-containing protein -
  HWI61_RS03535 (HWI61_03495) - 702130..702504 (+) 375 WP_002484718.1 hypothetical protein -
  HWI61_RS03540 (HWI61_03500) - 702504..702695 (+) 192 WP_002484773.1 hypothetical protein -
  HWI61_RS03545 (HWI61_03505) - 702696..703055 (+) 360 WP_002484760.1 SA1788 family PVL leukocidin-associated protein -
  HWI61_RS03550 (HWI61_03510) - 703052..703504 (+) 453 WP_002484724.1 DUF3310 domain-containing protein -
  HWI61_RS03555 (HWI61_03515) - 703494..703781 (+) 288 WP_002484753.1 hypothetical protein -
  HWI61_RS03560 (HWI61_03520) - 703797..704477 (+) 681 WP_002504784.1 hypothetical protein -
  HWI61_RS03565 (HWI61_03525) - 704474..704674 (+) 201 WP_002504783.1 hypothetical protein -
  HWI61_RS03570 (HWI61_03530) - 704658..705011 (+) 354 WP_002504782.1 hypothetical protein -
  HWI61_RS03575 (HWI61_03535) - 704992..705189 (+) 198 WP_002504781.1 Lar family restriction alleviation protein -
  HWI61_RS03580 (HWI61_03540) - 705190..705717 (+) 528 WP_002504780.1 dUTPase -
  HWI61_RS03585 (HWI61_03545) - 705879..706037 (+) 159 WP_002504779.1 DUF1381 domain-containing protein -
  HWI61_RS03590 (HWI61_03550) - 706096..706374 (+) 279 WP_002504778.1 hypothetical protein -
  HWI61_RS03595 (HWI61_03555) rinB 706367..706534 (+) 168 WP_002504777.1 transcriptional activator RinB -
  HWI61_RS03600 (HWI61_03560) - 706534..706683 (+) 150 WP_002484731.1 DUF1514 family protein -
  HWI61_RS03605 (HWI61_03565) - 706700..707146 (+) 447 WP_002484732.1 transcriptional regulator -
  HWI61_RS03610 (HWI61_03570) - 707741..708091 (+) 351 WP_002504776.1 HNH endonuclease -
  HWI61_RS03615 (HWI61_03575) - 708234..708704 (+) 471 WP_002484733.1 phage terminase small subunit P27 family -
  HWI61_RS03620 (HWI61_03580) - 708697..710448 (+) 1752 WP_002484749.1 terminase large subunit -
  HWI61_RS03625 (HWI61_03585) - 710460..710654 (+) 195 WP_002500102.1 hypothetical protein -
  HWI61_RS03630 (HWI61_03590) - 710657..711889 (+) 1233 WP_002504774.1 phage portal protein -
  HWI61_RS03635 (HWI61_03595) - 711879..712436 (+) 558 WP_002504773.1 HK97 family phage prohead protease -
  HWI61_RS03640 (HWI61_03600) - 712476..713825 (+) 1350 WP_002504772.1 phage major capsid protein -
  HWI61_RS03645 (HWI61_03605) - 713844..714185 (+) 342 WP_002484745.1 head-tail connector protein -
  HWI61_RS03650 (HWI61_03610) - 714175..714504 (+) 330 WP_002484730.1 hypothetical protein -
  HWI61_RS03655 (HWI61_03615) - 714618..714905 (+) 288 WP_002484720.1 hypothetical protein -
  HWI61_RS03660 (HWI61_03620) - 714908..715312 (+) 405 WP_002484722.1 hypothetical protein -
  HWI61_RS03665 (HWI61_03625) - 715325..715954 (+) 630 WP_002484765.1 major tail protein -
  HWI61_RS03670 (HWI61_03630) - 715973..716158 (+) 186 WP_002484762.1 hypothetical protein -
  HWI61_RS03675 (HWI61_03635) gpG 716222..716584 (+) 363 WP_002484709.1 phage tail assembly chaperone G -
  HWI61_RS03680 (HWI61_03640) gpGT 716629..716769 (+) 141 WP_002484764.1 phage tail assembly chaperone GT -
  HWI61_RS03685 (HWI61_03645) - 716798..721354 (+) 4557 WP_002504771.1 peptidoglycan DD-metalloendopeptidase family protein -
  HWI61_RS03690 (HWI61_03650) - 721356..722189 (+) 834 WP_002504770.1 phage tail domain-containing protein -
  HWI61_RS03695 (HWI61_03655) - 722199..723758 (+) 1560 WP_002504769.1 prophage endopeptidase tail family protein -
  HWI61_RS03700 (HWI61_03660) - 723751..723924 (+) 174 WP_002456411.1 hypothetical protein -
  HWI61_RS03705 (HWI61_03665) - 723940..725802 (+) 1863 WP_002504768.1 M14 family metallopeptidase -
  HWI61_RS03710 (HWI61_03670) - 725802..727016 (+) 1215 WP_002504767.1 BppU family phage baseplate upper protein -
  HWI61_RS03715 (HWI61_03675) - 727021..727644 (+) 624 WP_002504766.1 poly-gamma-glutamate hydrolase family protein -
  HWI61_RS03720 (HWI61_03680) - 727641..728066 (+) 426 WP_002456415.1 hypothetical protein -
  HWI61_RS03725 (HWI61_03685) - 728053..728460 (+) 408 WP_002504154.1 hypothetical protein -
  HWI61_RS03730 (HWI61_03690) - 728586..728852 (+) 267 WP_002504765.1 phage holin -
  HWI61_RS03735 (HWI61_03695) - 728852..730234 (+) 1383 WP_002504764.1 N-acetylmuramoyl-L-alanine amidase -
  HWI61_RS03740 (HWI61_03700) - 730312..731238 (+) 927 WP_002504133.1 hypothetical protein -
  HWI61_RS03745 (HWI61_03705) - 731431..731958 (+) 528 WP_002504240.1 Panacea domain-containing protein -
  HWI61_RS03750 (HWI61_03710) - 731948..732346 (+) 399 WP_002504241.1 hypothetical protein -

Sequence


Protein


Download         Length: 191 a.a.        Molecular weight: 22782.87 Da        Isoelectric Point: 9.2887

>NTDB_id=502118 HWI61_RS03380 WP_001829272.1 688792..689367(+) (comK/comK1) [Staphylococcus epidermidis strain UMCG389]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN

Nucleotide


Download         Length: 576 bp        

>NTDB_id=502118 HWI61_RS03380 WP_001829272.1 688792..689367(+) (comK/comK1) [Staphylococcus epidermidis strain UMCG389]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG

Domains


Predicted by InterproScan.

(7-158)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.757

96.859

0.743

  comK/comK1 Staphylococcus aureus N315

76.757

96.859

0.743