Detailed information    

insolico Bioinformatically predicted

Overview

Name   crp   Type   Regulator
Locus tag   IUJ44_RS11915 Genome accession   NZ_CP064375
Coordinates   2501967..2502674 (-) Length   235 a.a.
NCBI ID   WP_000203217.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain PartI-Abaumannii-RM8376 isolate ATCC isolate     
Function   regulate competence development (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2450398..2501806 2501967..2502674 flank 161


Gene organization within MGE regions


Location: 2450398..2502674
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IUJ44_RS11590 (IUJ44_11580) - 2450398..2450613 (-) 216 WP_000362184.1 hypothetical protein -
  IUJ44_RS11595 (IUJ44_11585) - 2450615..2451337 (-) 723 WP_002134341.1 hypothetical protein -
  IUJ44_RS11600 (IUJ44_11590) - 2451334..2451813 (-) 480 WP_000481377.1 hypothetical protein -
  IUJ44_RS11605 (IUJ44_11595) - 2451816..2452061 (-) 246 WP_000654845.1 hypothetical protein -
  IUJ44_RS11610 (IUJ44_11600) - 2452063..2453142 (-) 1080 WP_000183024.1 hypothetical protein -
  IUJ44_RS11615 (IUJ44_11605) - 2453147..2453353 (-) 207 WP_000664312.1 hypothetical protein -
  IUJ44_RS11620 (IUJ44_11610) - 2453350..2454471 (-) 1122 WP_001207471.1 ATP-binding protein -
  IUJ44_RS11625 (IUJ44_11615) - 2454483..2454806 (-) 324 WP_000064475.1 hypothetical protein -
  IUJ44_RS11630 (IUJ44_11620) - 2454799..2455089 (-) 291 WP_000656411.1 hypothetical protein -
  IUJ44_RS11635 (IUJ44_11625) - 2455089..2455529 (-) 441 WP_001101440.1 hypothetical protein -
  IUJ44_RS11640 (IUJ44_11630) - 2455754..2456545 (-) 792 WP_000187985.1 S24 family peptidase -
  IUJ44_RS11645 (IUJ44_11635) - 2456548..2456796 (+) 249 WP_000210973.1 Cro/CI family transcriptional regulator -
  IUJ44_RS11650 (IUJ44_11640) - 2456851..2457351 (+) 501 WP_001289843.1 phage regulatory CII family protein -
  IUJ44_RS11655 (IUJ44_11645) - 2457402..2457689 (+) 288 WP_001194329.1 hypothetical protein -
  IUJ44_RS11660 (IUJ44_11650) - 2457686..2458600 (+) 915 WP_001003656.1 DNA cytosine methyltransferase -
  IUJ44_RS11665 (IUJ44_11655) - 2458597..2459547 (+) 951 WP_001110397.1 YdaU family protein -
  IUJ44_RS11670 (IUJ44_11660) - 2459540..2460289 (+) 750 WP_000544505.1 hypothetical protein -
  IUJ44_RS11675 (IUJ44_11665) - 2460286..2460639 (+) 354 WP_000647822.1 hypothetical protein -
  IUJ44_RS11680 (IUJ44_11670) - 2460632..2461090 (+) 459 WP_000483334.1 hypothetical protein -
  IUJ44_RS11685 (IUJ44_11675) - 2461094..2461432 (+) 339 WP_000356502.1 hypothetical protein -
  IUJ44_RS11690 (IUJ44_11680) - 2461429..2461833 (+) 405 WP_000203142.1 DUF1064 domain-containing protein -
  IUJ44_RS11695 (IUJ44_11685) - 2461836..2462249 (+) 414 WP_000992314.1 antiterminator Q family protein -
  IUJ44_RS11700 (IUJ44_11690) - 2462513..2463187 (-) 675 WP_001066067.1 hypothetical protein -
  IUJ44_RS11705 (IUJ44_11695) - 2463502..2463780 (+) 279 WP_001115719.1 hypothetical protein -
  IUJ44_RS11710 (IUJ44_11700) - 2463832..2464299 (+) 468 WP_000341079.1 hypothetical protein -
  IUJ44_RS11715 (IUJ44_11705) - 2464268..2464909 (+) 642 WP_001984948.1 putative metallopeptidase -
  IUJ44_RS11720 (IUJ44_11710) - 2464968..2465444 (+) 477 WP_000729395.1 DUF2280 domain-containing protein -
  IUJ44_RS11725 (IUJ44_11715) terL 2465422..2466948 (+) 1527 WP_001088666.1 phage terminase large subunit -
  IUJ44_RS11730 (IUJ44_11720) - 2466957..2468291 (+) 1335 WP_000852320.1 DUF1073 domain-containing protein -
  IUJ44_RS11735 (IUJ44_11725) - 2468236..2469048 (+) 813 WP_000207481.1 phage minor head protein -
  IUJ44_RS11740 (IUJ44_11730) - 2469020..2469571 (-) 552 WP_001016202.1 hypothetical protein -
  IUJ44_RS11745 (IUJ44_11735) - 2469660..2469959 (+) 300 WP_000823404.1 hypothetical protein -
  IUJ44_RS11750 (IUJ44_11740) - 2470202..2471404 (+) 1203 WP_000160522.1 DUF2213 domain-containing protein -
  IUJ44_RS11755 (IUJ44_11745) - 2471418..2471888 (+) 471 WP_000240726.1 hypothetical protein -
  IUJ44_RS11760 (IUJ44_11750) - 2471894..2472868 (+) 975 WP_000039808.1 DUF2184 domain-containing protein -
  IUJ44_RS11765 (IUJ44_11755) - 2472882..2473265 (+) 384 WP_000877802.1 hypothetical protein -
  IUJ44_RS11770 (IUJ44_11760) - 2473275..2473658 (+) 384 WP_000383137.1 DUF4054 domain-containing protein -
  IUJ44_RS11775 (IUJ44_11765) - 2473668..2473859 (+) 192 WP_001116150.1 hypothetical protein -
  IUJ44_RS11780 (IUJ44_11770) - 2473867..2474349 (+) 483 WP_001287055.1 hypothetical protein -
  IUJ44_RS11785 (IUJ44_11775) - 2474342..2474785 (+) 444 WP_000376614.1 hypothetical protein -
  IUJ44_RS11790 (IUJ44_11780) - 2474848..2475615 (+) 768 WP_000090027.1 hypothetical protein -
  IUJ44_RS11795 (IUJ44_11785) - 2475622..2475936 (+) 315 WP_001159813.1 hypothetical protein -
  IUJ44_RS11800 (IUJ44_11790) - 2475972..2476199 (+) 228 WP_000513918.1 hypothetical protein -
  IUJ44_RS11805 (IUJ44_11795) - 2476270..2476770 (+) 501 WP_001229359.1 zinc ribbon domain-containing protein -
  IUJ44_RS11810 (IUJ44_11800) - 2476865..2479903 (+) 3039 WP_000002828.1 hypothetical protein -
  IUJ44_RS11815 (IUJ44_11805) - 2479914..2480567 (+) 654 WP_000073188.1 DUF2460 domain-containing protein -
  IUJ44_RS11820 (IUJ44_11810) - 2480564..2481421 (+) 858 WP_001248150.1 DUF2163 domain-containing protein -
  IUJ44_RS11825 (IUJ44_11815) - 2481478..2483280 (+) 1803 WP_001130838.1 sialate O-acetylesterase -
  IUJ44_RS11830 (IUJ44_11820) - 2483284..2484054 (+) 771 WP_000008889.1 hypothetical protein -
  IUJ44_RS11835 (IUJ44_11825) - 2484055..2484477 (+) 423 WP_000792723.1 NlpC/P60 family protein -
  IUJ44_RS11840 (IUJ44_11830) - 2484478..2486967 (+) 2490 WP_000509186.1 phage tail protein -
  IUJ44_RS11845 (IUJ44_11835) - 2487031..2487420 (+) 390 WP_000433918.1 hypothetical protein -
  IUJ44_RS11850 (IUJ44_11840) - 2487462..2488007 (+) 546 WP_001984959.1 N-acetylmuramidase -
  IUJ44_RS11855 (IUJ44_11845) - 2488008..2488325 (+) 318 WP_001076408.1 DUF6527 family protein -
  IUJ44_RS11860 (IUJ44_11850) - 2488413..2489111 (-) 699 WP_000692787.1 hypothetical protein -
  IUJ44_RS11865 (IUJ44_11855) - 2489156..2490454 (-) 1299 WP_000679991.1 Y-family DNA polymerase -
  IUJ44_RS11870 (IUJ44_11860) umuD 2490458..2490952 (-) 495 WP_001289322.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
  IUJ44_RS11875 (IUJ44_11865) - 2491114..2492319 (-) 1206 WP_001229158.1 site-specific integrase -
  IUJ44_RS11880 (IUJ44_11870) alaS 2492606..2495242 (-) 2637 WP_000199456.1 alanine--tRNA ligase -
  IUJ44_RS11885 (IUJ44_11875) gap 2495512..2496537 (+) 1026 WP_001188826.1 type I glyceraldehyde-3-phosphate dehydrogenase -
  IUJ44_RS11890 (IUJ44_11880) - 2496813..2497979 (+) 1167 WP_000155680.1 ATP phosphoribosyltransferase regulatory subunit -
  IUJ44_RS11895 (IUJ44_11885) - 2498044..2499363 (+) 1320 WP_000517793.1 adenylosuccinate synthase -
  IUJ44_RS11900 (IUJ44_11890) - 2499485..2499802 (+) 318 WP_000776215.1 hypothetical protein -
  IUJ44_RS11905 (IUJ44_11895) - 2499919..2500698 (+) 780 WP_001034598.1 M48 family metallopeptidase -
  IUJ44_RS11910 (IUJ44_11900) - 2500757..2501806 (-) 1050 WP_001159810.1 NADP(H)-dependent aldo-keto reductase -
  IUJ44_RS11915 (IUJ44_11905) crp 2501967..2502674 (-) 708 WP_000203217.1 cAMP-activated global transcriptional regulator CRP Regulator

Sequence

Protein


Download         Length: 235 a.a.        Molecular weight: 26567.18 Da        Isoelectric Point: 4.6625

>NTDB_id=501336 IUJ44_RS11915 WP_000203217.1 2501967..2502674(-) (crp) [Acinetobacter baumannii strain PartI-Abaumannii-RM8376 isolate ATCC isolate]
MTSNFSQLSTDALSPGQLPESVKALLKRAHINRYPKRTTIVDAGTESKSLYLILKGSVSIILREDDEREIVVAYLNPGDF
FGEMGLFEPNPQRTAEVRTRDVCEIAEISYDNFHELSKQYPDLSYAVFAQLVRRLKNTTRKMTDLAFIDVSGRIARCLID
LSSQPEAMILPNGRQIRITRQEIGRIVGCSREMVGRVLKTLEDQGMIQTDGKAILIFDTSLEETPVTDEDYDDEE

Nucleotide


Download         Length: 708 bp        

>NTDB_id=501336 IUJ44_RS11915 WP_000203217.1 2501967..2502674(-) (crp) [Acinetobacter baumannii strain PartI-Abaumannii-RM8376 isolate ATCC isolate]
ATGACTTCAAATTTTTCACAACTCAGCACAGATGCTTTATCTCCGGGGCAACTACCTGAATCCGTTAAAGCATTGTTAAA
ACGTGCTCACATCAACAGATATCCAAAACGAACCACAATTGTTGATGCCGGAACAGAGTCAAAATCTTTATATTTAATTT
TAAAAGGCTCAGTTTCAATTATTTTACGTGAAGACGATGAACGTGAAATTGTTGTGGCATATTTGAATCCTGGTGACTTC
TTTGGGGAAATGGGGCTTTTCGAACCGAACCCTCAACGTACAGCTGAAGTTCGTACCCGTGATGTCTGTGAAATTGCAGA
AATTTCATATGACAACTTCCACGAACTGAGCAAACAGTATCCAGATCTCAGCTATGCCGTTTTCGCGCAACTCGTTCGTC
GTTTAAAAAATACAACTCGTAAAATGACCGATCTTGCATTTATTGATGTGTCAGGTCGTATTGCGCGTTGCTTAATCGAC
CTATCTTCACAACCAGAAGCAATGATCTTGCCGAATGGCCGTCAAATTCGTATTACTCGACAAGAGATTGGACGCATTGT
CGGGTGTTCACGAGAAATGGTTGGCCGTGTATTAAAGACCTTAGAAGATCAAGGTATGATTCAAACTGACGGTAAAGCTA
TTCTAATTTTTGATACTTCATTAGAAGAAACCCCAGTCACTGACGAAGACTATGATGACGAAGAATAA

Domains

Predicted by InterproScan.

Crp-like helix-turn-helix domain (HTH_Crp_2)

(152-218)

Cyclic nucleotide-binding domain (cNMP_binding)

(33-120)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  crp Acinetobacter baumannii D1279779

99.574

100

0.996
  crp Vibrio cholerae strain A1552

47.343

88.085

0.417
  crp Haemophilus influenzae Rd KW20

48.705

82.128

0.4