Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IRJ28_RS05780 Genome accession   NZ_CP064096
Coordinates   1086718..1086891 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain N1142-3at     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1081718..1091891
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ28_RS05735 comGE 1082069..1082416 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  IRJ28_RS05740 comGF 1082442..1082825 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  IRJ28_RS05745 comGG 1082826..1083200 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  IRJ28_RS05750 spoIIT 1083271..1083450 (+) 180 WP_003230176.1 YqzE family protein -
  IRJ28_RS05755 yqzG 1083492..1083818 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  IRJ28_RS05760 tapA 1084090..1084851 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ28_RS05765 sipW 1084835..1085407 (+) 573 WP_003246088.1 signal peptidase I -
  IRJ28_RS05770 tasA 1085471..1086256 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  IRJ28_RS05775 sinR 1086349..1086684 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IRJ28_RS05780 sinI 1086718..1086891 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  IRJ28_RS05785 yqhG 1087074..1087868 (-) 795 WP_003230200.1 YqhG family protein -
  IRJ28_RS05790 yqhH 1087889..1089562 (-) 1674 WP_004398544.1 SNF2-related protein -
  IRJ28_RS05795 gcvT 1090004..1091092 (+) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=499465 IRJ28_RS05780 WP_003230187.1 1086718..1086891(-) (sinI) [Bacillus subtilis strain N1142-3at]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=499465 IRJ28_RS05780 WP_003230187.1 1086718..1086891(-) (sinI) [Bacillus subtilis strain N1142-3at]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1