Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   IRJ27_RS18730 Genome accession   NZ_CP064095
Coordinates   3622354..3622527 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain N1303-2Ay     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3617354..3627527
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ27_RS18685 comGE 3617705..3618052 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  IRJ27_RS18690 comGF 3618078..3618461 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  IRJ27_RS18695 comGG 3618462..3618836 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  IRJ27_RS18700 spoIIT 3618907..3619086 (+) 180 WP_003230176.1 YqzE family protein -
  IRJ27_RS18705 yqzG 3619128..3619454 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  IRJ27_RS18710 tapA 3619726..3620487 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ27_RS18715 sipW 3620471..3621043 (+) 573 WP_003246088.1 signal peptidase I -
  IRJ27_RS18720 tasA 3621107..3621892 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  IRJ27_RS18725 sinR 3621985..3622320 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IRJ27_RS18730 sinI 3622354..3622527 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  IRJ27_RS18735 yqhG 3622710..3623504 (-) 795 WP_003230200.1 YqhG family protein -
  IRJ27_RS18740 yqhH 3623525..3625198 (-) 1674 WP_004398544.1 SNF2-related protein -
  IRJ27_RS18745 gcvT 3625640..3626728 (+) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=499434 IRJ27_RS18730 WP_003230187.1 3622354..3622527(-) (sinI) [Bacillus subtilis strain N1303-2Ay]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=499434 IRJ27_RS18730 WP_003230187.1 3622354..3622527(-) (sinI) [Bacillus subtilis strain N1303-2Ay]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1