Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IRJ26_RS16540 Genome accession   NZ_CP064094
Coordinates   3133497..3133670 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain N1108-5at     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3128497..3138670
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ26_RS16495 comGE 3128848..3129195 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  IRJ26_RS16500 comGF 3129221..3129604 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  IRJ26_RS16505 comGG 3129605..3129979 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  IRJ26_RS16510 spoIIT 3130050..3130229 (+) 180 WP_003230176.1 YqzE family protein -
  IRJ26_RS16515 yqzG 3130271..3130597 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  IRJ26_RS16520 tapA 3130869..3131630 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ26_RS16525 sipW 3131614..3132186 (+) 573 WP_003246088.1 signal peptidase I -
  IRJ26_RS16530 tasA 3132250..3133035 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  IRJ26_RS16535 sinR 3133128..3133463 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IRJ26_RS16540 sinI 3133497..3133670 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  IRJ26_RS16545 yqhG 3133853..3134647 (-) 795 WP_003230200.1 YqhG family protein -
  IRJ26_RS16550 yqhH 3134668..3136341 (-) 1674 WP_004398544.1 SNF2-related protein -
  IRJ26_RS16555 gcvT 3136783..3137871 (+) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=499342 IRJ26_RS16540 WP_003230187.1 3133497..3133670(-) (sinI) [Bacillus subtilis strain N1108-5at]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=499342 IRJ26_RS16540 WP_003230187.1 3133497..3133670(-) (sinI) [Bacillus subtilis strain N1108-5at]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1