Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   IRJ26_RS16500 Genome accession   NZ_CP064094
Coordinates   3129221..3129604 (+) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain N1108-5at     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3124221..3134604
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ26_RS16470 corA 3124674..3125627 (+) 954 WP_004399136.1 magnesium transporter CorA -
  IRJ26_RS16475 comGA 3126039..3127109 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  IRJ26_RS16480 comGB 3127096..3128133 (+) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  IRJ26_RS16485 comGC 3128147..3128443 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  IRJ26_RS16490 comGD 3128433..3128864 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  IRJ26_RS16495 comGE 3128848..3129195 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  IRJ26_RS16500 comGF 3129221..3129604 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  IRJ26_RS16505 comGG 3129605..3129979 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  IRJ26_RS16510 spoIIT 3130050..3130229 (+) 180 WP_003230176.1 YqzE family protein -
  IRJ26_RS16515 yqzG 3130271..3130597 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  IRJ26_RS16520 tapA 3130869..3131630 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ26_RS16525 sipW 3131614..3132186 (+) 573 WP_003246088.1 signal peptidase I -
  IRJ26_RS16530 tasA 3132250..3133035 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  IRJ26_RS16535 sinR 3133128..3133463 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IRJ26_RS16540 sinI 3133497..3133670 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=499339 IRJ26_RS16500 WP_003230168.1 3129221..3129604(+) (comGF) [Bacillus subtilis strain N1108-5at]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=499339 IRJ26_RS16500 WP_003230168.1 3129221..3129604(+) (comGF) [Bacillus subtilis strain N1108-5at]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1