Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IRJ22_RS08355 Genome accession   NZ_CP064092
Coordinates   1596843..1597019 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain C5     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1591843..1602019
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ22_RS08340 gcvT 1592485..1593579 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  IRJ22_RS08345 - 1594172..1595851 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  IRJ22_RS08350 - 1595858..1596652 (+) 795 WP_003183441.1 YqhG family protein -
  IRJ22_RS08355 sinI 1596843..1597019 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  IRJ22_RS08360 sinR 1597053..1597388 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  IRJ22_RS08365 tasA 1597493..1598287 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  IRJ22_RS08370 sipW 1598361..1598945 (-) 585 WP_003183449.1 signal peptidase I SipW -
  IRJ22_RS08375 tapA 1598942..1599670 (-) 729 WP_011198112.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ22_RS08380 - 1599947..1600267 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  IRJ22_RS08385 - 1600297..1600479 (-) 183 WP_003183456.1 YqzE family protein -
  IRJ22_RS08390 comGG 1600568..1600933 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  IRJ22_RS08395 comGF 1600946..1601434 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  IRJ22_RS08400 comGE 1601343..1601690 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=499138 IRJ22_RS08355 WP_003183444.1 1596843..1597019(+) (sinI) [Bacillus licheniformis strain C5]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=499138 IRJ22_RS08355 WP_003183444.1 1596843..1597019(+) (sinI) [Bacillus licheniformis strain C5]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517