Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IRJ21_RS04430 Genome accession   NZ_CP064091
Coordinates   1008350..1008523 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain C1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1003350..1013523
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ21_RS04415 gcvT 1004163..1005263 (-) 1101 WP_174747062.1 glycine cleavage system aminomethyltransferase GcvT -
  IRJ21_RS04420 - 1005687..1007357 (+) 1671 WP_154817561.1 SNF2-related protein -
  IRJ21_RS04425 - 1007379..1008173 (+) 795 WP_242790626.1 YqhG family protein -
  IRJ21_RS04430 sinI 1008350..1008523 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  IRJ21_RS04435 sinR 1008557..1008892 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IRJ21_RS04440 - 1008940..1009725 (-) 786 WP_007408329.1 TasA family protein -
  IRJ21_RS04445 - 1009790..1010374 (-) 585 WP_012117977.1 signal peptidase I -
  IRJ21_RS04450 tapA 1010346..1011017 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ21_RS04455 - 1011276..1011605 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  IRJ21_RS04460 - 1011646..1011825 (-) 180 WP_003153093.1 YqzE family protein -
  IRJ21_RS04465 comGG 1011882..1012259 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  IRJ21_RS04470 comGF 1012260..1012655 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  IRJ21_RS04475 comGE 1012669..1012983 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  IRJ21_RS04480 comGD 1012967..1013404 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=499042 IRJ21_RS04430 WP_014418369.1 1008350..1008523(+) (sinI) [Bacillus velezensis strain C1]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=499042 IRJ21_RS04430 WP_014418369.1 1008350..1008523(+) (sinI) [Bacillus velezensis strain C1]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719