Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   IRJ21_RS04475 Genome accession   NZ_CP064091
Coordinates   1012669..1012983 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain C1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1007669..1017983
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ21_RS04430 sinI 1008350..1008523 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  IRJ21_RS04435 sinR 1008557..1008892 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IRJ21_RS04440 - 1008940..1009725 (-) 786 WP_007408329.1 TasA family protein -
  IRJ21_RS04445 - 1009790..1010374 (-) 585 WP_012117977.1 signal peptidase I -
  IRJ21_RS04450 tapA 1010346..1011017 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ21_RS04455 - 1011276..1011605 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  IRJ21_RS04460 - 1011646..1011825 (-) 180 WP_003153093.1 YqzE family protein -
  IRJ21_RS04465 comGG 1011882..1012259 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  IRJ21_RS04470 comGF 1012260..1012655 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  IRJ21_RS04475 comGE 1012669..1012983 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  IRJ21_RS04480 comGD 1012967..1013404 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  IRJ21_RS04485 comGC 1013394..1013660 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  IRJ21_RS04490 comGB 1013707..1014744 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  IRJ21_RS04495 comGA 1014731..1015801 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  IRJ21_RS04500 - 1015994..1016944 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=499045 IRJ21_RS04475 WP_017418140.1 1012669..1012983(-) (comGE) [Bacillus velezensis strain C1]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=499045 IRJ21_RS04475 WP_017418140.1 1012669..1012983(-) (comGE) [Bacillus velezensis strain C1]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481