Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   KHS93_RS15085 Genome accession   NZ_CP075547
Coordinates   3070764..3070943 (-) Length   59 a.a.
NCBI ID   WP_306383677.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain SN16-1     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3065764..3075943
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHS93_RS15055 (KHS93_15055) - 3066153..3066629 (+) 477 WP_003152059.1 Na+/H+ antiporter subunit E -
  KHS93_RS15060 (KHS93_15060) - 3066629..3066913 (+) 285 WP_003152057.1 Na(+)/H(+) antiporter subunit F1 -
  KHS93_RS15065 (KHS93_15065) mnhG 3066897..3067271 (+) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  KHS93_RS15070 (KHS93_15070) - 3067311..3067694 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  KHS93_RS15075 (KHS93_15075) comA 3067716..3068360 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  KHS93_RS15080 (KHS93_15080) - 3068441..3070744 (-) 2304 Protein_2928 histidine kinase -
  KHS93_RS15085 (KHS93_15085) comX 3070764..3070943 (-) 180 WP_306383677.1 competence pheromone ComX Regulator
  KHS93_RS15090 (KHS93_15090) comQ 3070897..3071883 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  KHS93_RS15095 (KHS93_15095) degQ 3072014..3072154 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  KHS93_RS15100 (KHS93_15100) - 3072620..3072961 (+) 342 WP_003152040.1 hypothetical protein -
  KHS93_RS15105 (KHS93_15105) - 3072968..3074188 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  KHS93_RS15110 (KHS93_15110) - 3074318..3075784 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 59 a.a.        Molecular weight: 6965.10 Da        Isoelectric Point: 6.1890

>NTDB_id=498859 KHS93_RS15085 WP_306383677.1 3070764..3070943(-) (comX) [Bacillus amyloliquefaciens strain SN16-1]
MMKMQNLINYFLNYPDVLKKLKSNEASLIGYDSIQTQIIIKGFENYLMMGADNKKWDNE

Nucleotide


Download         Length: 180 bp        

>NTDB_id=498859 KHS93_RS15085 WP_306383677.1 3070764..3070943(-) (comX) [Bacillus amyloliquefaciens strain SN16-1]
ATGATGAAGATGCAGAATTTAATAAATTATTTTTTGAATTATCCTGATGTATTAAAGAAACTGAAAAGCAATGAAGCTAG
CCTTATCGGTTATGACTCTATACAAACGCAAATTATCATTAAAGGGTTTGAGAATTATTTAATGATGGGTGCGGACAATA
AAAAATGGGATAATGAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

52.83

89.831

0.475