Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KIL00_RS17155 Genome accession   NZ_CP075344
Coordinates   3256605..3256745 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain A1 - Midalam     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3251605..3261745
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KIL00_RS17130 (KIL00_17130) yuxO 3251918..3252298 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  KIL00_RS17135 (KIL00_17135) comA 3252317..3252961 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KIL00_RS17140 (KIL00_17140) comP 3253042..3255351 (-) 2310 WP_213783444.1 histidine kinase Regulator
  KIL00_RS17145 (KIL00_17145) comX 3255366..3255533 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  KIL00_RS17150 (KIL00_17150) comQ 3255521..3256420 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  KIL00_RS17155 (KIL00_17155) degQ 3256605..3256745 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KIL00_RS17160 (KIL00_17160) - 3256967..3257092 (+) 126 WP_003228793.1 hypothetical protein -
  KIL00_RS17165 (KIL00_17165) - 3257207..3257575 (+) 369 WP_046381300.1 hypothetical protein -
  KIL00_RS17170 (KIL00_17170) pdeH 3257551..3258780 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  KIL00_RS17175 (KIL00_17175) pncB 3258916..3260388 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KIL00_RS17180 (KIL00_17180) pncA 3260404..3260955 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  KIL00_RS17185 (KIL00_17185) yueI 3261052..3261450 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=497839 KIL00_RS17155 WP_003220708.1 3256605..3256745(-) (degQ) [Bacillus subtilis subsp. subtilis strain A1 - Midalam]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=497839 KIL00_RS17155 WP_003220708.1 3256605..3256745(-) (degQ) [Bacillus subtilis subsp. subtilis strain A1 - Midalam]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1